Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate CA265_RS11615 CA265_RS11615 3-dehydroquinate synthase
Query= curated2:A6LEZ7 (353 letters) >FitnessBrowser__Pedo557:CA265_RS11615 Length = 352 Score = 260 bits (664), Expect = 4e-74 Identities = 149/335 (44%), Positives = 196/335 (58%), Gaps = 8/335 (2%) Query: 16 LQDFLSSLKYDKLFILMDTNTKEKCFPLVEDI-PAFQKAPILVMEAGDMNKGFVSLAQIW 74 L+ L S KY K+F+L D +T E C PL + + F + ++ AG+ NK IW Sbjct: 20 LKTLLESNKYSKVFVLADEHTSEICLPLFQSLLDDFSEFDLIETSAGEENKNIDFCIGIW 79 Query: 75 TALSNEGASRNSLLVNLGGGMITDMGGFAGATFKRGIRTINIPTTLMASVDAAVGGKTGI 134 L + A R SL++NLGGG+ITDMGGF +T+KRGI IN+PTTL++ VDA+VGGKTGI Sbjct: 80 KTLLDFEADRKSLMINLGGGVITDMGGFIASTYKRGIDFINVPTTLLSQVDASVGGKTGI 139 Query: 135 NFNGLKNEVGSFYPPLCVFIDCDFLRTLDRDNILSGYAEMIKHGLISSMENYASVMLFDI 194 + + +KN VG+F P VFI+ FL+TL + +LSG+AEMIKHGLI Y + Sbjct: 140 DIDNVKNMVGTFTLPQMVFIETAFLKTLPQRELLSGFAEMIKHGLIYDKPYYEK-----L 194 Query: 195 DTMNYSYLNSL-VGQSVAVKERIVEEDPKEQGIRKALNFGHTIGHAFESLSFLK-MRPIL 252 NY ++ + +SV +K +V DP E+ +RK LNFGHTIGHA E S P+ Sbjct: 195 KESNYLTPSAEDIYRSVEIKNEVVTIDPHEKNLRKILNFGHTIGHAVEGYSLANDENPLT 254 Query: 253 HGHAVAAGIVSELYLSHKLCGFPMEKLSQVVYYIKEYYPALFFDCTDYDTLYELMTHDKK 312 HG A+A G V E LS K +L + YI YP +DTL ELM DKK Sbjct: 255 HGEAIAIGFVCEAALSIKNSTLTQAELKDISEYILSLYPKYHIKKESFDTLLELMQSDKK 314 Query: 313 NEGGIINFTLLKNVGDVRINQSVTKEKILESLDFY 347 NE G I F+LL+ G N V+ IL SLD+Y Sbjct: 315 NEDGNILFSLLETTGKCTFNCRVSTADILSSLDYY 349 Lambda K H 0.321 0.139 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 352 Length adjustment: 29 Effective length of query: 324 Effective length of database: 323 Effective search space: 104652 Effective search space used: 104652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS11615 CA265_RS11615 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.5511.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-107 344.3 0.0 4.9e-107 344.0 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS11615 CA265_RS11615 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS11615 CA265_RS11615 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.0 0.0 4.9e-107 4.9e-107 13 341 .. 20 344 .. 10 347 .. 0.93 Alignments for each domain: == domain 1 score: 344.0 bits; conditional E-value: 4.9e-107 TIGR01357 13 lveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldqlleek 79 l + l++ k sk++v+ de++++++ ++++l + +e + + ++gee+K+++ + ++++ll+ + lcl|FitnessBrowser__Pedo557:CA265_RS11615 20 LKTLLESnKYSKVFVLADEHTSEICLPLFQSLLDD-FSEFDLIETSAGEENKNIDFCIGIWKTLLDFE 86 44455554569**********************88.9999**************************** PP TIGR01357 80 lerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqP 147 ++rks+++++GGGv++D++GF+A+ty+RGi++++vPTtll++vD+svGGKtgi+ +++kN++G+f P lcl|FitnessBrowser__Pedo557:CA265_RS11615 87 ADRKSLMINLGGGVITDMGGFIASTYKRGIDFINVPTTLLSQVDASVGGKTGIDIDNVKNMVGTFTLP 154 ******************************************************************** PP TIGR01357 148 kaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKa 215 ++V+i++++l+tlp+rel +G+aE+iKhgli+d+ +e+l++ + l +e i rs+e+K+ lcl|FitnessBrowser__Pedo557:CA265_RS11615 155 QMVFIETAFLKTLPQRELLSGFAEMIKHGLIYDKPYYEKLKESNYL-------TPSAEDIYRSVEIKN 215 ****************************************996653.......3456789******** PP TIGR01357 216 evVeeDekesglRalLNfGHtlgHaiEallkyk....lsHGeaVaiGmvveaklseklgllkaeller 279 evV+ D++e+ lR++LNfGHt+gHa+E + + l+HGea+aiG v+ea ls k +l + +l++ lcl|FitnessBrowser__Pedo557:CA265_RS11615 216 EVVTIDPHEKNLRKILNFGHTIGHAVEGYSLANdenpLTHGEAIAIGFVCEAALSIKNSTLTQAELKD 283 ***************************8765555689******************************* PP TIGR01357 280 lvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 + +++ +l++++++kk s+++ll+ +++DKKne+++i + lle Gk++ +++v+ ++l+ lcl|FitnessBrowser__Pedo557:CA265_RS11615 284 ISEYILSLYPKYHIKK-ESFDTLLELMQSDKKNEDGNILFSLLETTGKCTFNCRVSTADILS 344 ********99999997.9**********************************9998777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.12 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory