Align S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) (EC 2.5.1.144); cysteine synthase (EC 2.5.1.47) (characterized)
to candidate CA265_RS10150 CA265_RS10150 cysteine synthase B
Query= BRENDA::P29848 (303 letters) >FitnessBrowser__Pedo557:CA265_RS10150 Length = 290 Score = 310 bits (795), Expect = 2e-89 Identities = 161/289 (55%), Positives = 204/289 (70%), Gaps = 9/289 (3%) Query: 8 IGNTPLVKLQRLGPDNGSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDVLIEA 67 IGNTP+ +LQ+L + ++ KLEGNNP GSVKDRA+L+MI A +RG++ PG L+EA Sbjct: 8 IGNTPMAELQKLNINPAVRVFAKLEGNNPGGSVKDRASLNMIRSAIERGDVVPGTKLVEA 67 Query: 68 TSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGARDLAL 127 TSGNTGIALAMIA+L ++L+MP N ++ER+ M A+GA++ L+ + +E RD A Sbjct: 68 TSGNTGIALAMIASLYNLEIELVMPANSTRERKVTMEAFGAKVTLL---ESIEDCRDYA- 123 Query: 128 AMSERGEGK---LLDQFNNPDNPYAHYTTTGPEIWRQTSGRITHFVSSMGTTGTITGVSR 184 E+G K LL+QF NPDN AHY TTGPEIWR T G ITHFVSSMGTTGTI G SR Sbjct: 124 --EEKGVSKGYFLLNQFANPDNYLAHYKTTGPEIWRDTEGEITHFVSSMGTTGTIMGCSR 181 Query: 185 FLREQEKPVTIVGLQPEEGSSIPGIRRWPAEYMPGIFNASLVDEVLDIHQNDAENTMREL 244 F +E+ + I+G QP EGSSIPGIRRWP EY+P IF+ VD V+DI Q +A R + Sbjct: 182 FFKEKNNDIQIIGCQPTEGSSIPGIRRWPEEYLPKIFDPLRVDRVMDIAQEEATLMSRRM 241 Query: 245 AVREGIFCGVSSGGAVAGALRVARATPGAIVVAIICDRGDRYLSTGVFG 293 A EG+F G+SSGGA A AL++A +V I CDRGDRYLS+ +FG Sbjct: 242 AKEEGLFAGMSSGGACAAALKLASELDKGTIVFIACDRGDRYLSSDLFG 290 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 290 Length adjustment: 26 Effective length of query: 277 Effective length of database: 264 Effective search space: 73128 Effective search space used: 73128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate CA265_RS10150 CA265_RS10150 (cysteine synthase B)
to HMM TIGR01136 (cysteine synthase (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01136.hmm # target sequence database: /tmp/gapView.32074.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01136 [M=299] Accession: TIGR01136 Description: cysKM: cysteine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-108 346.4 0.0 8.2e-108 346.2 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS10150 CA265_RS10150 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS10150 CA265_RS10150 cysteine synthase B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 346.2 0.0 8.2e-108 8.2e-108 2 299 .] 5 289 .. 4 289 .. 0.97 Alignments for each domain: == domain 1 score: 346.2 bits; conditional E-value: 8.2e-108 TIGR01136 2 eeliGntPlvrln.lseelkaevlvKlEsrnPsgSvKdRialsmildAekrgllkkgktiieatSGNt 68 +liGntP+ +l+ l+ + +++v++KlE++nP+gSvKdR++l+mi +A +rg + +g++++eatSGNt lcl|FitnessBrowser__Pedo557:CA265_RS10150 5 IDLIGNTPMAELQkLNINPAVRVFAKLEGNNPGGSVKDRASLNMIRSAIERGDVVPGTKLVEATSGNT 72 589**********999999************************************************* PP TIGR01136 69 GiaLAmvaaakgyklilvmpetmslERrkllkayGaelvlteaeegmkgaiekakelaeeepekyvll 136 GiaLAm+a ++++ lvmp++ + ER+ +++a+Ga++ l e+ + +++ a+e +++ y+ll lcl|FitnessBrowser__Pedo557:CA265_RS10150 73 GIALAMIASLYNLEIELVMPANSTRERKVTMEAFGAKVTLLES---IEDCRDYAEEKGVSKG--YFLL 135 ****************************************876...5678999999998866..99** PP TIGR01136 137 kqfeNpaNpeaHrkttgpEilkdtdgkidafvagvGtgGtitGvgrvlkekkpnvkivavePaespvl 204 +qf+Np+N aH+kttgpEi++dt+g+i++fv+++Gt+Gti+G +r++kek+++++i++++P+e++ lcl|FitnessBrowser__Pedo557:CA265_RS10150 136 NQFANPDNYLAHYKTTGPEIWRDTEGEITHFVSSMGTTGTIMGCSRFFKEKNNDIQIIGCQPTEGSS- 202 ******************************************************************9. PP TIGR01136 205 segkpgphkiqgigagfiPkildeelldevikvededaietarrlakeegilvGiSsGaavaaalkva 272 + g i++++++++Pki+d +d+v+++ +e+a+ ++rr+akeeg+++G+SsG+a+aaalk+a lcl|FitnessBrowser__Pedo557:CA265_RS10150 203 IPG------IRRWPEEYLPKIFDPLRVDRVMDIAQEEATLMSRRMAKEEGLFAGMSSGGACAAALKLA 264 888......9********************************************************** PP TIGR01136 273 kklekedkkivvilpdagerYLstelf 299 +l+ + +iv i++d+g+rYLs++lf lcl|FitnessBrowser__Pedo557:CA265_RS10150 265 SELD--KGTIVFIACDRGDRYLSSDLF 289 ***8..69*****************99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory