Align 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (characterized)
to candidate CA265_RS03615 CA265_RS03615 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase
Query= reanno::Pedo557:CA265_RS03615 (249 letters) >FitnessBrowser__Pedo557:CA265_RS03615 Length = 249 Score = 492 bits (1267), Expect = e-144 Identities = 249/249 (100%), Positives = 249/249 (100%) Query: 1 MYIIPAIDILDGKVVRLREGDYNQKTEYAVSIPEMIEKYRSNGTDFIHIIDLNGAKGDFS 60 MYIIPAIDILDGKVVRLREGDYNQKTEYAVSIPEMIEKYRSNGTDFIHIIDLNGAKGDFS Sbjct: 1 MYIIPAIDILDGKVVRLREGDYNQKTEYAVSIPEMIEKYRSNGTDFIHIIDLNGAKGDFS 60 Query: 61 NQKTLFEIIKKTEMKVQYGGGIRTIEQVTNLLDAGIHRVIVGTQAITNPDFLPQLSEAFA 120 NQKTLFEIIKKTEMKVQYGGGIRTIEQVTNLLDAGIHRVIVGTQAITNPDFLPQLSEAFA Sbjct: 61 NQKTLFEIIKKTEMKVQYGGGIRTIEQVTNLLDAGIHRVIVGTQAITNPDFLPQLSEAFA 120 Query: 121 KKDDYANRIVIAIDVLDEVIKYSGWMESSPIKLMDYVDKCLSLGFFRFLCTDISKDGKLG 180 KKDDYANRIVIAIDVLDEVIKYSGWMESSPIKLMDYVDKCLSLGFFRFLCTDISKDGKLG Sbjct: 121 KKDDYANRIVIAIDVLDEVIKYSGWMESSPIKLMDYVDKCLSLGFFRFLCTDISKDGKLG 180 Query: 181 GAAIDLYEKLLEHSPMIKLIASGGVSSMQDIYDLAKYPIRSVVVGKAIYEDRITIEEIKE 240 GAAIDLYEKLLEHSPMIKLIASGGVSSMQDIYDLAKYPIRSVVVGKAIYEDRITIEEIKE Sbjct: 181 GAAIDLYEKLLEHSPMIKLIASGGVSSMQDIYDLAKYPIRSVVVGKAIYEDRITIEEIKE 240 Query: 241 WNLKALSSI 249 WNLKALSSI Sbjct: 241 WNLKALSSI 249 Lambda K H 0.320 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 249 Length adjustment: 24 Effective length of query: 225 Effective length of database: 225 Effective search space: 50625 Effective search space used: 50625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate CA265_RS03615 CA265_RS03615 (1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase)
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.22096.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-72 230.0 0.2 1.7e-72 229.8 0.2 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS03615 CA265_RS03615 1-(5-phosphoribosy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS03615 CA265_RS03615 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylidenea # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 229.8 0.2 1.7e-72 1.7e-72 1 230 [. 3 237 .. 3 238 .. 0.96 Alignments for each domain: == domain 1 score: 229.8 bits; conditional E-value: 1.7e-72 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkiv 68 iiPaiD+ +Gkvvrl +Gd+++kt y+ ++ e+++k++++g +++H++DL+gAk+ +n++++ +i+ lcl|FitnessBrowser__Pedo557:CA265_RS03615 3 IIPAIDILDGKVVRLREGDYNQKTEYAVSIPEMIEKYRSNGTDFIHIIDLNGAKGDF-SNQKTLFEII 69 8****************************************************9887.7999999*** PP TIGR00007 69 eelevkvqvGGGiRsleavekllelgverviigtaavenpelvkellkelgse.....kivvslDake 131 +++e+kvq GGGiR++e+v++ll++g++rvi+gt a++np+++ +l +++ ++ +iv+++D+ + lcl|FitnessBrowser__Pedo557:CA265_RS03615 70 KKTEMKVQYGGGIRTIEQVTNLLDAGIHRVIVGTQAITNPDFLPQLSEAFAKKddyanRIVIAIDVLD 137 *******************************************9999888754455559********* PP TIGR00007 132 gevavkGWkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvke.aeveviasGGv 198 + ++ +GW e+s ++l++ + k +lg ++++Tdi+kdG+l G ++l+++l+++ +++iasGGv lcl|FitnessBrowser__Pedo557:CA265_RS03615 138 EVIKYSGWMESSPIKLMDYVDKCLSLGFFRFLCTDISKDGKLGGAAIDLYEKLLEHsPMIKLIASGGV 205 ********************************************************999********* PP TIGR00007 199 ssiedvkalkklgvkgvivGkAlyegklklke 230 ss++d+ l+k ++ v+vGkA+ye +++++e lcl|FitnessBrowser__Pedo557:CA265_RS03615 206 SSMQDIYDLAKYPIRSVVVGKAIYEDRITIEE 237 ****************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (249 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 5.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory