Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate CA265_RS03630 CA265_RS03630 histidinol-phosphate transaminase
Query= reanno::Btheta:349730 (346 letters) >FitnessBrowser__Pedo557:CA265_RS03630 Length = 346 Score = 387 bits (994), Expect = e-112 Identities = 192/345 (55%), Positives = 250/345 (72%), Gaps = 5/345 (1%) Query: 4 LQELTRPNIWKLKPYSSARDEYKGAVASVFLDANENPYNLP----HNRYPDPMQWELKTL 59 + +L R NI L+PYS+ARDE+KG ASVFLDANEN Y P +NRYPDP+Q +LK Sbjct: 3 INDLVRENIKNLRPYSTARDEFKGQ-ASVFLDANENSYGSPLPANYNRYPDPLQLDLKDA 61 Query: 60 LSKIKKVSPQHIFLGNGSDEAIDLVFRAFCEPEKDNVVAIDPTYGMYQVCADVNNVEYRK 119 +SKIK V ++ FLGNGSDEAIDL+FRAFC P KDNV+ + PTYGMY+V A++N+VE RK Sbjct: 62 ISKIKGVPIENTFLGNGSDEAIDLLFRAFCNPGKDNVIVLPPTYGMYEVSANINDVEIRK 121 Query: 120 VLLDENFQFSAEKLLAATDERTKLIFLCSPNNPTGNDLLRSEIEKILREFEGLVILDEAY 179 V L NFQ EK+ D+ TKLIF+CSPNNPTGN + R +IE IL F G+V++DEAY Sbjct: 122 VSLLPNFQLDMEKIAETIDKNTKLIFICSPNNPTGNSINREDIETILANFNGIVVVDEAY 181 Query: 180 NDFSEAPSFLEELDKYPNLVVFQTFSKAWGCAAIRLGMAFASEAIIGILSKIKYPYNVNQ 239 +++ +F++EL +Y NLVV QTFSKAWG AA+RLGMAF+S +I +L+KIK PYN+NQ Sbjct: 182 INYARQKTFIQELTEYGNLVVLQTFSKAWGLAALRLGMAFSSTKVIDVLNKIKPPYNINQ 241 Query: 240 LTQQQAIAMLHKYYEIERWIKTLKEERDYLEEEFAKLSCTVRMYPSDSNFFLAKVTDAVK 299 TQ A L ++ WIK ERD L + L+ ++YPSD+NF L +VTDA+K Sbjct: 242 ATQDLAFEALKNIAQVNDWIKESVAERDRLSKALTALNIVKKVYPSDANFILTEVTDALK 301 Query: 300 IYNYLVGEGIIVRNRHSISLCCNCLRVTVGTRVENNTLLAALKKY 344 IY+ LV +GIIVR+R ++LC CLR+TVGT+ EN+ LL L+ + Sbjct: 302 IYDTLVDQGIIVRDRSKVTLCEGCLRITVGTKEENDKLLTVLENF 346 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 346 Length adjustment: 29 Effective length of query: 317 Effective length of database: 317 Effective search space: 100489 Effective search space used: 100489 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS03630 CA265_RS03630 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.32313.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-117 378.7 0.2 1.3e-117 378.5 0.2 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS03630 CA265_RS03630 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS03630 CA265_RS03630 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 378.5 0.2 1.3e-117 1.3e-117 1 348 [. 8 345 .. 8 346 .] 0.97 Alignments for each domain: == domain 1 score: 378.5 bits; conditional E-value: 1.3e-117 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakyl 68 re+ik+l pY+++ +e+ +++ v L++nEn +g + l + + +rYpdp +l+lk a++k lcl|FitnessBrowser__Pedo557:CA265_RS03630 8 RENIKNLRPYSTARDEFKGQASVFLDANENSYGSP------LP-A--NYNRYPDPLQLDLKDAISKIK 66 799*********76677777***************......33.3..69******************* PP TIGR01141 69 gveeenillgnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqedlea 135 gv en +lgnGsde+i+ll+raf++pg d+v+vl+pty mYevsa+i+++e+++v+l ++q d+e+ lcl|FitnessBrowser__Pedo557:CA265_RS03630 67 GVPIENTFLGNGSDEAIDLLFRAFCNPGkDNVIVLPPTYGMYEVSANINDVEIRKVSLLPNFQLDMEK 134 ******************************************************************** PP TIGR01141 136 vleaakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlv 203 ++e++++++kl+f++sPnnPtGn+++re+ie++l++ +++VVvDeAYi++++++++++ l+ey nlv lcl|FitnessBrowser__Pedo557:CA265_RS03630 135 IAETIDKNTKLIFICSPNNPTGNSINREDIETILANF-NGIVVVDEAYINYARQKTFIQELTEYGNLV 201 ************************************8.9***************************** PP TIGR01141 204 vlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkere 271 vl+T+SKa gLA+lR+G+a+++ ++i++l+k+++pyn+++ ++++a +al++ +++++ ++e+ +er+ lcl|FitnessBrowser__Pedo557:CA265_RS03630 202 VLQTFSKAWGLAALRLGMAFSSTKVIDVLNKIKPPYNINQATQDLAFEALKNIAQVNDWIKESVAERD 269 ******************************************************************** PP TIGR01141 272 rlleelkklegle.vyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtree 338 rl ++l++l+ ++ vy+S+aNF+l +v da +++++l+++giivRd +++ l+e+clRitvGt+ee lcl|FitnessBrowser__Pedo557:CA265_RS03630 270 RLSKALTALNIVKkVYPSDANFILTEVT-DALKIYDTLVDQGIIVRDRSKV-TLCEGCLRITVGTKEE 335 ************9**************9.********************99.589************* PP TIGR01141 339 nerllealke 348 n++ll++l++ lcl|FitnessBrowser__Pedo557:CA265_RS03630 336 NDKLLTVLEN 345 *******986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.68 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory