Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate CA265_RS19260 CA265_RS19260 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q4FNT7 (251 letters) >FitnessBrowser__Pedo557:CA265_RS19260 Length = 255 Score = 151 bits (381), Expect = 1e-41 Identities = 84/236 (35%), Positives = 142/236 (60%), Gaps = 4/236 (1%) Query: 1 MLKNRIIPCLDV-KNGRVVKGINFVDLKDAGDPVEQAKIYSDGGADEICFLDITASKENR 59 MLK+R+IP L + ++G +VK F K GDP+ +I++ DE+ LDI ASK R Sbjct: 1 MLKHRVIPALLLNQHGGLVKTTKFAAPKYIGDPLNAMRIFNTKEVDELMVLDIDASKLKR 60 Query: 60 DTIYDVVERTSKKCFVPLTVGGGVRGVEDINKLLNCGADKVSINTAAVQSPEMIIESSKK 119 + Y ++E+ + +CF+PL GGG++ ++ K+ G +K+ + TA ++ +++ + + Sbjct: 61 EPNYGLIEQFAGECFMPLCYGGGIKTIDQAYKIFKLGVEKICLQTAVLEDLDLVRDLVAR 120 Query: 120 FGSQCIVVAIDAKKNG-DKWEVFTHGGRNNTNIDAIEFAKKMEDNGAGELLVTSMDRDGT 178 FGS IVV++D KK+ + ++F N N + I + K+ D GAGE+L+ ++D+DGT Sbjct: 121 FGSSAIVVSVDVKKDWLQRPKLFKSSEGKNANENWISYIKQAVDAGAGEILLNAVDKDGT 180 Query: 179 QIGYDNDLMFKISSTVNIPIIASGGVGNLDHLVDGIRLGNASAVLAASIF-HYGTH 233 G D L+ + S ++ P+IA GG+G+L + D + G ASAV A + F +G H Sbjct: 181 LQGSDLTLIKQASGEISAPLIALGGIGSLKDIKDAVDAG-ASAVAAGAFFVFHGPH 235 Lambda K H 0.317 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 255 Length adjustment: 24 Effective length of query: 227 Effective length of database: 231 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory