Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate CA265_RS15670 CA265_RS15670 4-hydroxy-tetrahydrodipicolinate reductase
Query= reanno::Pedo557:CA265_RS15670 (244 letters) >FitnessBrowser__Pedo557:CA265_RS15670 Length = 244 Score = 489 bits (1260), Expect = e-143 Identities = 244/244 (100%), Positives = 244/244 (100%) Query: 1 MKLALLGYGKMGQIIEKFAVERGHEIVLKITIDNQEDLTRQNLKSADVAIDFSTPDSVLK 60 MKLALLGYGKMGQIIEKFAVERGHEIVLKITIDNQEDLTRQNLKSADVAIDFSTPDSVLK Sbjct: 1 MKLALLGYGKMGQIIEKFAVERGHEIVLKITIDNQEDLTRQNLKSADVAIDFSTPDSVLK 60 Query: 61 NIDACFDANVPIVVGTTGWYGKLQEVKDDCNNSNNTLLYGSNFSIGVNLFFKLNQTLAKL 120 NIDACFDANVPIVVGTTGWYGKLQEVKDDCNNSNNTLLYGSNFSIGVNLFFKLNQTLAKL Sbjct: 61 NIDACFDANVPIVVGTTGWYGKLQEVKDDCNNSNNTLLYGSNFSIGVNLFFKLNQTLAKL 120 Query: 121 MNNYPAYEVQVEEIHHTQKLDAPSGTAITLAEGIVDNLDRKQEWLNEVVGTDVELFPKAE 180 MNNYPAYEVQVEEIHHTQKLDAPSGTAITLAEGIVDNLDRKQEWLNEVVGTDVELFPKAE Sbjct: 121 MNNYPAYEVQVEEIHHTQKLDAPSGTAITLAEGIVDNLDRKQEWLNEVVGTDVELFPKAE 180 Query: 181 QLLIESHRIENIPGTHTVIYSSEVDEIEIKHTAHNRAGFALGAVVAAEWLKDKKGFFSIT 240 QLLIESHRIENIPGTHTVIYSSEVDEIEIKHTAHNRAGFALGAVVAAEWLKDKKGFFSIT Sbjct: 181 QLLIESHRIENIPGTHTVIYSSEVDEIEIKHTAHNRAGFALGAVVAAEWLKDKKGFFSIT 240 Query: 241 DIFE 244 DIFE Sbjct: 241 DIFE 244 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 244 Length adjustment: 24 Effective length of query: 220 Effective length of database: 220 Effective search space: 48400 Effective search space used: 48400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate CA265_RS15670 CA265_RS15670 (4-hydroxy-tetrahydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.8545.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-50 155.9 0.1 1e-49 155.5 0.1 1.2 1 lcl|FitnessBrowser__Pedo557:CA265_RS15670 CA265_RS15670 4-hydroxy-tetrahyd Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS15670 CA265_RS15670 4-hydroxy-tetrahydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 155.5 0.1 1e-49 1e-49 58 269 .. 30 243 .. 3 244 .] 0.84 Alignments for each domain: == domain 1 score: 155.5 bits; conditional E-value: 1e-49 TIGR00036 58 veddleavkvla.ekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgva 124 ++ d + + + + k+adv iDf+tp++vl+n+ ++ +++v +VvGTTG +l+e+kd ++++ + lcl|FitnessBrowser__Pedo557:CA265_RS15670 30 ITIDNQEDLTRQnLKSADVAIDFSTPDSVLKNIDACFDANVPIVVGTTGWYG-KLQEVKDDCNNSNNT 96 33333333333337899********************************986.689999999999*** PP TIGR00036 125 lviapNfaiGvnlllkllekaakvledv...DiEiiElHHrhKkDaPSGTAlklaeiiakargkdlk. 188 l++ +Nf+iGvnl++kl +++ak ++++ ++ + E+HH +K DaPSGTA+ lae i ++ +++++ lcl|FitnessBrowser__Pedo557:CA265_RS15670 97 LLYGSNFSIGVNLFFKLNQTLAKLMNNYpayEVQVEEIHHTQKLDAPSGTAITLAEGIVDNLDRKQEw 164 **************************9876689999***********************999953331 PP TIGR00036 189 ..eaaveeregltGerkkeeiGiaavRggdvvgehtvlFasdGerleitHkassRaafakGvvrairw 254 e++ + e + k+e+ i + R ++ g htv++ s+ + +ei+H+a++Ra fa G+v a++w lcl|FitnessBrowser__Pedo557:CA265_RS15670 165 lnEVVGTDVELF--P-KAEQLLIESHRIENIPGTHTVIYSSEVDEIEIKHTAHNRAGFALGAVVAAEW 229 102222333333..3.589999********************************************** PP TIGR00036 255 ledkeekvydledvl 269 l+dk+ +++ ++d++ lcl|FitnessBrowser__Pedo557:CA265_RS15670 230 LKDKK-GFFSITDIF 243 *9975.789999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (244 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 2.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory