Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate CA265_RS08175 CA265_RS08175 homoserine O-acetyltransferase
Query= SwissProt::K4ICC9 (336 letters) >FitnessBrowser__Pedo557:CA265_RS08175 Length = 352 Score = 375 bits (964), Expect = e-109 Identities = 180/332 (54%), Positives = 239/332 (71%), Gaps = 1/332 (0%) Query: 5 FKYQDPFQLENGEVLPELEVSYSTLGKLNKEKSNVIWVCHALTANAQPEDWWRGLIGNEK 64 + Y F+LE+G+ + L+++Y T GKLN K NVIWVCHALTANA +WW GL G Sbjct: 7 YHYNKQFKLESGKKIRNLQIAYQTYGKLNANKDNVIWVCHALTANADVFEWWEGLFGQNS 66 Query: 65 GIDTEKYFIVCANIIGSCYGSTNPKSINPETGEVYGLNFPLFSIRDVTKSLELLSEALEI 124 + E+++IVCAN++GS YGS+NP S NP TG Y L+FP F+IRD+ + +LL+ L I Sbjct: 67 LFNPEEHYIVCANVLGSHYGSSNPLSTNPVTGLPYYLSFPQFTIRDLVSAHQLLASHLGI 126 Query: 125 EHIQFLIGGSMGGMQAMEWAIEKPDKIKNLILLATNAKHSSWGIALNETQRMAIEADSTF 184 ++I+ LIGGS+GG QA+EW+I +P+KI+NLIL+ATNA HS WGIA NE+QR+AI D TF Sbjct: 127 DYIKLLIGGSLGGQQAVEWSISEPNKIENLILIATNAAHSPWGIAFNESQRLAITTDRTF 186 Query: 185 YKKETNSGKKGLEAARAIALLSYRNYNTYRHTQVDQ-EHTADHFRASTYQKYQGEKLSKR 243 Y + N G KGL+ AR+IALLSYR Y+ Y TQV+ D+FR+S+YQ YQGEKL R Sbjct: 187 YANQPNGGSKGLKTARSIALLSYRTYSAYGSTQVESVNDKTDNFRSSSYQNYQGEKLINR 246 Query: 244 FNAKCYWYLSKAMDSHNVGRNRGDCKKALAKIKAETLVIAVQSDLLFPVEEQRFLAQYIP 303 FNA Y+YL+KAMDSHNVGRNR AL I A TLVI +++D+LFP+ EQ++LA +IP Sbjct: 247 FNAYSYYYLTKAMDSHNVGRNRKSIADALKLITANTLVIGIENDVLFPLSEQKYLADHIP 306 Query: 304 KGKLEIIDSIYGHDGFLIEVEKIKSLVHKHFK 335 + + S YGHDGFLIE + + +++ K Sbjct: 307 GAEFSALHSDYGHDGFLIETDALTNVIGNFIK 338 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 352 Length adjustment: 29 Effective length of query: 307 Effective length of database: 323 Effective search space: 99161 Effective search space used: 99161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS08175 CA265_RS08175 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.22742.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-107 344.2 0.1 5e-107 343.9 0.1 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS08175 CA265_RS08175 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS08175 CA265_RS08175 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 343.9 0.1 5e-107 5e-107 3 350 .. 11 337 .. 9 338 .. 0.95 Alignments for each domain: == domain 1 score: 343.9 bits; conditional E-value: 5e-107 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedkGWWdellGpgraldt 70 ++++lesG++++++++ay+tyG+lna++dN++ vcHalt++a+v + WW+ l+G++ +++ lcl|FitnessBrowser__Pedo557:CA265_RS08175 11 KQFKLESGKKIRNLQIAYQTYGKLNANKDNVIWVCHALTANADVF---E-----WWEGLFGQNSLFNP 70 79******************************************9...6.....************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlG 138 +++++vc+NvlGs +Gs+ Pls+np tg py +fP++tirDlv a++ l+ +Lg++ +++ +GgSlG lcl|FitnessBrowser__Pedo557:CA265_RS08175 71 EEHYIVCANVLGSHYGSSNPLSTNPVTGLPYYLSFPQFTIRDLVSAHQLLASHLGIDYIKLLIGGSLG 138 ******************************************************************** PP TIGR01392 139 GmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARm 206 G qa+ew++s+p+++++++ +at a++s++ iafne qr ai++D + + + +kGL++AR lcl|FitnessBrowser__Pedo557:CA265_RS08175 139 GQQAVEWSISEPNKIENLILIATNAAHSPWGIAFNESQRLAITTDRTFYANQPNG---GSKGLKTARS 203 ************************************************8887777...67******** PP TIGR01392 207 lalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 +all+Yr+ +++ + ++++++ +++f +sy +yqg+k+++rF+A sY +ltka+d+h++ lcl|FitnessBrowser__Pedo557:CA265_RS08175 204 IALLSYRTYSAYGSTQVESVNDK-------TDNFRSSSYQNYQGEKLINRFNAYSYYYLTKAMDSHNV 264 ********988765544333333.......57899********************************* PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakleyaeieseeGHDaFllekekv 342 +r+ r+s+++alk i+a++lv+gie D+lf+l+eq+ la++++ a+ + ++s++GHD+Fl+e++++ lcl|FitnessBrowser__Pedo557:CA265_RS08175 265 GRN-RKSIADALKLITANTLVIGIENDVLFPLSEQKYLADHIPGAEFS--ALHSDYGHDGFLIETDAL 329 **9.9**************************************99887..****************** PP TIGR01392 343 eelirefl 350 +++i +f+ lcl|FitnessBrowser__Pedo557:CA265_RS08175 330 TNVIGNFI 337 ****9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory