Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate CA265_RS06275 CA265_RS06275 aspartate kinase
Query= BRENDA::Q57991 (473 letters) >FitnessBrowser__Pedo557:CA265_RS06275 Length = 422 Score = 184 bits (466), Expect = 6e-51 Identities = 132/421 (31%), Positives = 214/421 (50%), Gaps = 40/421 (9%) Query: 4 VMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIA 63 + KFGG SV + +++VA IV KK ++++V+SAM +VT+ L +++Q L + A Sbjct: 3 IFKFGGASVKDADGVKNVANIVRDYKK--GNLLIVISAMGKVTDKLEKLTQAFLSQNNEA 60 Query: 64 KVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSR- 122 I+ H+ I+E + + + +++ + + +L E P + Sbjct: 61 HA--IFDEIKHFHFNIIDELFQGKA---------NPVYDDVANTFVEIDWLIEDEPDNNE 109 Query: 123 ----DYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLE----V 174 D I+S GE +S+ I++ + + G K++ + I TDN++ +V + + Sbjct: 110 DYIYDQIVSIGEVVSTKIVAAWLNETGNKTLWADARNY-IQTDNSYREGKVDWAKTNQMI 168 Query: 175 KERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSG 234 + LLPLL + II V GFIG T E Y TTLGR GSDYSAA+ L+A + IW DV G Sbjct: 169 QRDLLPLLNDNII-VTQGFIGGTSENYTTTLGREGSDYSAAIFASCLNAAALTIWKDVPG 227 Query: 235 VYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESE 294 V DP+ +I +LSY +A+EL Y+GA V+HP+TI+P KGIP+ V++ +PE Sbjct: 228 VLNADPKWFDETEKIAQLSYHDAIELTYYGATVIHPKTIKPLQNKGIPLFVRSFIQPEGS 287 Query: 295 GTLIT---NDMEMSDSIVKAISTIKNVALINIFGAG-MVGVSGTAARIFKALGEEEVNVI 350 GT IT N + + I K N ALI+IF + + IF+ ++ + Sbjct: 288 GTAITKENNPLPIPSFIFKV-----NQALISIFPKDYSFIIEENLSNIFELFHTHKIKIN 342 Query: 351 LISQGSSETNISLVVSEEDVDKALKALKREFGDFGKKS-------FLNNNLIRDVSVDKD 403 + + ++S+ ++K +K L EF K + N I V+VDKD Sbjct: 343 TMLNSAISFSVSVDDHPTQIEKLIKDLSEEFTVKYNKGLELVTIRYYNQQTIDRVTVDKD 402 Query: 404 V 404 + Sbjct: 403 I 403 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 422 Length adjustment: 33 Effective length of query: 440 Effective length of database: 389 Effective search space: 171160 Effective search space used: 171160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate CA265_RS06275 CA265_RS06275 (aspartate kinase)
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00657.hmm # target sequence database: /tmp/gapView.25936.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00657 [M=442] Accession: TIGR00657 Description: asp_kinases: aspartate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-88 282.1 0.0 5.7e-88 281.8 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS06275 CA265_RS06275 aspartate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS06275 CA265_RS06275 aspartate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 281.8 0.0 5.7e-88 5.7e-88 5 384 .. 3 386 .. 1 399 [. 0.94 Alignments for each domain: == domain 1 score: 281.8 bits; conditional E-value: 5.7e-88 TIGR00657 5 VqKFGGtSvgnverikkvakivkkekekgnqvvVVvSAmagvTdaLvelaekvsseee..keliekir 70 + KFGG Sv++++ +k+va+iv k kg + ++V+SAm++vTd+L +l + + s+++ +++ ++i+ lcl|FitnessBrowser__Pedo557:CA265_RS06275 3 IFKFGGASVKDADGVKNVANIVRDYK-KG-NLLIVISAMGKVTDKLEKLTQAFLSQNNeaHAIFDEIK 68 68******************998887.66.79********************99999878889999** PP TIGR00657 71 ekhlealeelasqalkeklkallekeleevkk..........ereldlilsvGEklSaallaaaleel 128 + h+++++el + ++ + +++++ ++e+ + +d i+s+GE +S++++aa+l+e lcl|FitnessBrowser__Pedo557:CA265_RS06275 69 HFHFNIIDELFQ-GKANPVYDDVANTFVEIDWliedepdnneDYIYDQIVSIGEVVSTKIVAAWLNET 135 ********9985.36778888888888888778889999999999*********************** PP TIGR00657 129 gvkavsllgaeagiltdsefgrAk....vleeikterleklleegiivvvaGFiGatekgeittLGRG 192 g ++ + +a++ i td+++++ k ++++++++ l++ll+ + i v++GFiG t+++++ttLGR lcl|FitnessBrowser__Pedo557:CA265_RS06275 136 G-NKTLWADARNYIQTDNSYREGKvdwaKTNQMIQRDLLPLLNDN-IIVTQGFIGGTSENYTTTLGRE 201 *.889999***************99999999************99.889******************* PP TIGR00657 193 GSDltAallAaalkAdeveiytDVdGiytaDPrivpeArrldeisyeEalELaslGakvLhprtlepa 260 GSD++Aa+ A++l+A + i++DV+G++ aDP+ e+ +++++sy+ a EL+++Ga v+hp+t++p+ lcl|FitnessBrowser__Pedo557:CA265_RS06275 202 GSDYSAAIFASCLNAAALTIWKDVPGVLNADPKWFDETEKIAQLSYHDAIELTYYGATVIHPKTIKPL 269 ******************************************************************** PP TIGR00657 261 mrakipivvkstfnpeaeGTlivakskseeepavkalsldknqalvsvsgttmk...pgilaevfgal 325 +++ip++v+s +pe+ GT i+++++ + ++ + ++ nqal+s+ + + + l+++f+ lcl|FitnessBrowser__Pedo557:CA265_RS06275 270 QNKGIPLFVRSFIQPEGSGTAITKENN---PLPIPSFIFKVNQALISIFPKDYSfiiEENLSNIFELF 334 ************************955...689*****************9999999999******** PP TIGR00657 326 aeakvnvdlilqsssetsisfvvdkedadkakellkkkvkeekaleevevekklalvsl 384 +++k++++++l ++ isf v+ +d ++ e+l +k++++ +v+++k+l lv++ lcl|FitnessBrowser__Pedo557:CA265_RS06275 335 HTHKIKINTML----NSAISFSVSVDDHPTQIEKL---IKDLSEEFTVKYNKGLELVTI 386 ***********....3369********99999996...7889999999*******9998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (442 nodes) Target sequences: 1 (422 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.65 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory