Align Indole-3-glycerol phosphate synthase; Short=IGPS; EC 4.1.1.48 (characterized, see rationale)
to candidate CA265_RS22900 CA265_RS22900 indole-3-glycerol phosphate synthase
Query= uniprot:TRPC_BACTN (260 letters) >FitnessBrowser__Pedo557:CA265_RS22900 Length = 260 Score = 228 bits (580), Expect = 1e-64 Identities = 123/259 (47%), Positives = 169/259 (65%), Gaps = 2/259 (0%) Query: 3 DILSEIIANKRFEVDLQKQAISIEQLQEGINEVPASRSMKRALASSD-SGIIAEFKRRSP 61 +IL +I+ K+ EV K +S++ L+ ++ A S K L ++D +GIIAEFKRRSP Sbjct: 2 NILDKIVLRKKEEVAAAKALVSVQDLENSVHFKRAPYSFKEFLLAADRTGIIAEFKRRSP 61 Query: 62 SKGWIKQEARPEEIVPSYLAAGASALSILTDEKFFGGSLKDIRTARPLVDVPIIRKDFII 121 SKG I A E+ +Y AAGASALS+LTD FFGG DI AR +PI+RKDF+I Sbjct: 62 SKGLINGVADVAEVTQAYNAAGASALSVLTDVDFFGGKTDDILAARAANHIPILRKDFMI 121 Query: 122 DEYQLYQAKIVGADAVLLIAAALKQEKCQELAEQAHELGLEVLLEIHSAEELP-YINSKI 180 D YQ+ +AK GAD +LLIA+ L ++ + + A +LGL VLLE+H+ EEL I + Sbjct: 122 DTYQILEAKAWGADIILLIASILTPQQINDFGKFAKDLGLNVLLEVHNLEELERSICPNL 181 Query: 181 DMIGINNRNLGTFFTDVENSFRLAGQLPQDAVLVSESGISDPEVVKRLRTAGFRGFLIGE 240 D IG+NNRNLG F D++ SF L ++P + + +SES IS+ + +K L+ AGF GFLIGE Sbjct: 182 DAIGVNNRNLGDFTVDIQTSFDLVNKIPNEFLKISESAISNTQTIKDLKAAGFNGFLIGE 241 Query: 241 TFMKTPQPGETLQNFLKAI 259 FMKT PG ++ F+ I Sbjct: 242 NFMKTDDPGVAIKEFVAQI 260 Lambda K H 0.317 0.135 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory