Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate GFF3439 PGA1_c34920 argininosuccinate synthase ArgG
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__Phaeo:GFF3439 Length = 408 Score = 491 bits (1263), Expect = e-143 Identities = 246/399 (61%), Positives = 300/399 (75%), Gaps = 5/399 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGAS--KAIAL 59 K+VLAYSGGLDTSIILKWL+ Y EV+ FTAD+GQGEE+E AR+KA G Sbjct: 6 KVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEELEPARQKAELLGIKPENIFIE 65 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 D++EEFVRDFVFPM RA AVYEG YLLGTSIARPLI+K LV IAE GA+A+AHGATGKG Sbjct: 66 DVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKRLVEIAEATGADAVAHGATGKG 125 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQ--EKPYSMDAN 177 NDQVRFEL AYAL PDIKVIAPWREW R ++ +AEAH IPV + E P+S+DAN Sbjct: 126 NDQVRFELAAYALNPDIKVIAPWREWDLTSRTRLLEFAEAHQIPVAKDKRGEAPFSVDAN 185 Query: 178 LLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAA 237 LLH S EG VLEDP P +++ T PE+AP+ E++E+ F +GD V++NGE +SPA Sbjct: 186 LLHTSSEGKVLEDPAVAAPDYVYQRTVHPEDAPNEAEFIEIGFEKGDAVSINGEAMSPAT 245 Query: 238 LLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQ 297 +L +LNE GG+HG+GR+D+VE RFVGMKSRG+YETPGGTIL A R +ES+T+DR +H Sbjct: 246 ILTQLNEYGGKHGIGRLDLVEGRFVGMKSRGIYETPGGTILLEAHRGIESITMDRGAMHL 305 Query: 298 RDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSL 357 +D L P+YAEL+Y GFWY+PERE LQA D VTG R+KLYKG+ VGR + SL Sbjct: 306 KDQLMPQYAELIYNGFWYSPEREMLQAAIDRSQEHVTGTVRVKLYKGSATTVGRWSDHSL 365 Query: 358 YRQDLVSF-DEAGGYDQKDAEGFIKIQALRLRVRALVER 395 Y + V+F D+AG YDQKDA GFI++ ALRL++ A ER Sbjct: 366 YSEAHVTFEDDAGAYDQKDAAGFIQLNALRLKLLAARER 404 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 408 Length adjustment: 31 Effective length of query: 369 Effective length of database: 377 Effective search space: 139113 Effective search space used: 139113 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF3439 PGA1_c34920 (argininosuccinate synthase ArgG)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.32524.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-145 469.8 0.0 5.1e-145 469.6 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3439 PGA1_c34920 argininosuccinate sy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3439 PGA1_c34920 argininosuccinate synthase ArgG # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 469.6 0.0 5.1e-145 5.1e-145 1 390 [. 6 400 .. 6 404 .. 0.97 Alignments for each domain: == domain 1 score: 469.6 bits; conditional E-value: 5.1e-145 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGa..ekayviDareefvkdylfaai 73 kvvlaysGGlDts++lk+l+ + g+ev+++t+d+Gq+ e+l+ +++ka lG e+ + D reefv+d++f+ lcl|FitnessBrowser__Phaeo:GFF3439 6 KVVLAYSGGLDTSIILKWLQTEyGCEVVTFTADLGQG-EELEPARQKAELLGIkpENIFIEDVREEFVRDFVFPMF 80 8*********************9*************9.9***********99722566777*************** PP TIGR00032 74 qanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkviaPvreleli.R 148 +anavyeg Yll+t++aRpli+k+lve+a+ ga+avahG+tgKGnDqvRFel ++lnpd+kviaP+re++l+ R lcl|FitnessBrowser__Phaeo:GFF3439 81 RANAVYEGLYLLGTSIARPLISKRLVEIAEATGADAVAHGATGKGNDQVRFELAAYALNPDIKVIAPWREWDLTsR 156 *************************************************************************99* PP TIGR00032 149 eeeieyaaekGievpvek..ekaysiDenllgrsiEageLEdpsteppediyelvkdpiektedepevveieFekG 222 + ++e+a+++ i+v+ +k e ++s+D nll+ s E++ LEdp ++ p+ +y+ +++p++++ +e+e +ei+FekG lcl|FitnessBrowser__Phaeo:GFF3439 157 TRLLEFAEAHQIPVAKDKrgEAPFSVDANLLHTSSEGKVLEDPAVAAPDYVYQRTVHPEDAP-NEAEFIEIGFEKG 231 **************99875579**********************************998888.999********** PP TIGR00032 223 vPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefke 298 v++nge ++p +++ ++ne +gkhG+Gr+D vE R +g+KsR+iYE+p+ ++L++Ah+ +e+ ++++ +++k+ lcl|FitnessBrowser__Phaeo:GFF3439 232 DAVSINGEAMSPATILTQLNEYGGKHGIGRLDLVEGRFVGMKSRGIYETPGGTILLEAHRGIESITMDRGAMHLKD 307 **************************************************************************** PP TIGR00032 299 iveekyseliYkGlwfdplaealdalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfek.dkefdqk 373 +y+eliY+G+w++p++e+l+a+i+++qe+vtGtvrvkl+kG+a+++gr s++slY+e v+fe ++dqk lcl|FitnessBrowser__Phaeo:GFF3439 308 QLMPQYAELIYNGFWYSPEREMLQAAIDRSQEHVTGTVRVKLYKGSATTVGRWSDHSLYSEAHVTFEDdAGAYDQK 383 *******************************************************************944589*** PP TIGR00032 374 daiGfikirglqikvyr 390 da+Gfi++++l+ k + lcl|FitnessBrowser__Phaeo:GFF3439 384 DAAGFIQLNALRLKLLA 400 ***********998765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (408 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.61 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory