Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate GFF3462 PGA1_c35150 shikimate dehydrogenase AroE
Query= reanno::Caulo:CCNA_00003 (285 letters) >FitnessBrowser__Phaeo:GFF3462 Length = 277 Score = 197 bits (502), Expect = 2e-55 Identities = 108/269 (40%), Positives = 148/269 (55%) Query: 11 VGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFAPAADRFETFVDGLRGGAVRGLNVTI 70 + GV G P+ HS SP++H W+ G+ YVP + E V L G N+TI Sbjct: 8 LAGVIGSPVAHSRSPLVHGHWLRTYGIAGHYVPLHVEPGQLEEVVRSLPKMGFVGANITI 67 Query: 71 PFKERALAVADTASDLARMAGAANLLVFNEDGSVHADNTDGPGLLGAIAIQAPGFDVTAA 130 P KE+ + +AD +D A + GAAN L+F DGS+ ADNTDG G + + AP +D Sbjct: 68 PHKEQIMEIADQVTDRATLIGAANTLIFRPDGSILADNTDGYGFITNLHQAAPDWDPATG 127 Query: 131 PVVILGAGGAARGAVAALLLAGAPRIAVVNRTVARAQDLADTFGEKVVAKGEDALPALLP 190 P V+ GAGGA+R +A+LL AG P I + NRT RA FG ++ + ++ Sbjct: 128 PAVVFGAGGASRAVIASLLEAGVPEILLSNRTRERADQFRSEFGSRIQVVDWVQVGNVIE 187 Query: 191 EAGLIINATSLGLGGGAGPSADLTLTPKTAVVMDMVYKPLRTEFLRRAEAAGRRTVDGLE 250 +A L++N TSLG+ G L + VV D+VY PL+T+ L+ AE G TVDGL Sbjct: 188 QAALLVNTTSLGMVGKPRLRVPLDGLRSSTVVTDLVYTPLKTDMLQWAEDIGCTTVDGLG 247 Query: 251 MLLRQAIPTFETIYGQAPSPKIDVRVLAL 279 MLL QA+P FE +G+ P R AL Sbjct: 248 MLLHQAVPGFERWFGKRPEVDAATREAAL 276 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 277 Length adjustment: 26 Effective length of query: 259 Effective length of database: 251 Effective search space: 65009 Effective search space used: 65009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF3462 PGA1_c35150 (shikimate dehydrogenase AroE)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.18503.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-71 225.1 0.0 5.1e-71 224.9 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3462 PGA1_c35150 shikimate dehydrogen Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3462 PGA1_c35150 shikimate dehydrogenase AroE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 224.9 0.0 5.1e-71 5.1e-71 2 263 .. 8 272 .. 7 277 .] 0.93 Alignments for each domain: == domain 1 score: 224.9 bits; conditional E-value: 5.1e-71 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeiees 77 l gviG p++hS spl+h + l++ g++++Y+ ++ve+ +le+++ + + g+ G+n+T+P+Ke+++e++D+++++ lcl|FitnessBrowser__Phaeo:GFF3462 8 LAGVIGSPVAHSRSPLVHGHWLRTYGIAGHYVPLHVEPGQLEEVVRSLPKMGFVGANITIPHKEQIMEIADQVTDR 83 679************************************************************************* PP TIGR00507 78 akligavNTlk.ledgklvgynTDgiGlvssLek..lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRt 149 a liga NTl + dg ++++nTDg+G++++L++ ++ + +++ GAGGa++av+ +Ll+a e+++ NRt lcl|FitnessBrowser__Phaeo:GFF3462 84 ATLIGAANTLIfRPDGSILADNTDGYGFITNLHQaaPDWDPATGPAVVFGAGGASRAVIASLLEAgVPEILLSNRT 159 **********9889********************733444456789*******************5569******* PP TIGR00507 150 vekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellkegklvvDlvynpletpllke 225 e+a + +++ + +++ + + ++ l++n+ts+g+ g+ v+ + l+++++v Dlvy pl+t +l++ lcl|FitnessBrowser__Phaeo:GFF3462 160 RERADQFRSEFGSRIQVVDWVQVGNVIEQAALLVNTTSLGMVGKP-RLRVPLDGLRSSTVVTDLVYTPLKTDMLQW 234 ***********9988888887777788999************987.99**************************** PP TIGR00507 226 akkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfe 263 a++ g+ ++dGlgMl +Qa+ Fe w+g p+v+ + + lcl|FitnessBrowser__Phaeo:GFF3462 235 AEDIGCTTVDGLGMLLHQAVPGFERWFGKRPEVDAATR 272 ********************************987654 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (277 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.21 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory