Align Histidinol dehydrogenase 1; HDH 1; EC 1.1.1.23 (uncharacterized)
to candidate GFF2695 PGA1_c27370 histidinol dehydrogenase HisD
Query= curated2:Q8YSM8 (431 letters) >FitnessBrowser__Phaeo:GFF2695 Length = 442 Score = 293 bits (750), Expect = 7e-84 Identities = 168/410 (40%), Positives = 237/410 (57%), Gaps = 3/410 (0%) Query: 20 SDRREATVDVSGTVRDILAHVKARGDAAVQEYTSRFDHYRPHSHHLSAAFIAEQAAKCSD 79 +DR E + V L ++ARGDAAV+E +FD+Y S+ LS A I AK S Sbjct: 13 ADRAEDDAKTASVVASTLKDIEARGDAAVRELACKFDNYDRDSYRLSEAEIEAIIAKVSP 72 Query: 80 EVKAALELAAERISSFHQKQLPQ--DIGYTDTAGVKLGLNWVALSQVGIYVPGGRASYPS 137 A ++ A ++++ F Q Q DI GV LG + + VG YVPGG+ + Sbjct: 73 REMADIQFAQDQVTKFAQAQRDSMLDIEVEPMPGVILGHKNIPVQSVGCYVPGGKFPMVA 132 Query: 138 SVLMNALPAKIAGVERIVMTVPMPHGEINPAVLAAAQVAGVTEIYSIGGAQAVGALAYGT 197 S M+ AK+AGV RIV P +GE NPAV+AA + G EIY +GG QAVGA+A GT Sbjct: 133 SAHMSVATAKVAGVPRIVACTPPFNGEPNPAVIAAMHLGGAHEIYVLGGIQAVGAMAIGT 192 Query: 198 ETITPVDKIVGPGNAYVAEAKRQVFGTVGIDSIAGPSEILVVADRQNNPEWIAWDLLSQA 257 E+I PV +VGPGNA+VAEAKRQ+FG VGID AGP+E +V+AD + E A DLL QA Sbjct: 193 ESIAPVHLLVGPGNAFVAEAKRQLFGRVGIDLFAGPTETMVIADDTVDAELCATDLLGQA 252 Query: 258 EHDPSAQSILITDSESFAQQVIAAVEQILTTLPSQKVASSSWQNHGAVIIVRDLAESIPL 317 EH ++ ++L+T+S + A+ + +++ILT LP+ A SW+++G VI+ E + + Sbjct: 253 EHGYNSPAVLVTNSRTLAEDTLKEIDRILTILPTAGTARVSWEDYGEVILCDSYDEMLAV 312 Query: 318 LNQLAPEHVELCVDNPQLLASQIKCAGSLFLGRYTPEAIGDYLGGPNHVLPTSRSARFAS 377 + +A EHV++ D + C G+LFLG T A GD + G NH LPT ++ R+ Sbjct: 313 ADDIASEHVQVMTDRDDWFLDNMTCYGALFLGPRTNVANGDKVIGTNHTLPTKKAGRYTG 372 Query: 378 GLSVYDFLKRITYLE-CNQAALQKIGQSAVTLAETEGLPAHAGSVAVRLQ 426 GL V FLK +Y + + A IG+ L EG HA +R++ Sbjct: 373 GLWVGKFLKTHSYQKVTSDEAATLIGEYGSRLCMLEGFVGHAEQCNIRVR 422 Lambda K H 0.316 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 442 Length adjustment: 32 Effective length of query: 399 Effective length of database: 410 Effective search space: 163590 Effective search space used: 163590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate GFF2695 PGA1_c27370 (histidinol dehydrogenase HisD)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.11301.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-132 427.1 0.0 4.6e-132 426.9 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2695 PGA1_c27370 histidinol dehydroge Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2695 PGA1_c27370 histidinol dehydrogenase HisD # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.9 0.0 4.6e-132 4.6e-132 1 393 [] 26 420 .. 26 420 .. 0.98 Alignments for each domain: == domain 1 score: 426.9 bits; conditional E-value: 4.6e-132 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlpes..vev 74 v++ ++d++++Gd+A++e++ kfd+++ +s r+se+e+e+ ++v+++ ++++ a+++++kf+++q+++ +ev lcl|FitnessBrowser__Phaeo:GFF2695 26 VASTLKDIEARGDAAVRELACKFDNYDRDSYRLSEAEIEAIIAKVSPREMADIQFAQDQVTKFAQAQRDSMldIEV 101 567799**************************************************************99766899 PP TIGR00069 75 eteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnpavlaaakllgvdev 150 e ++gv+lg+k p+++vg+YvPgGk ++++++ m + +AkvAgv++iv++tPp +g+ npav+aa++l g++e+ lcl|FitnessBrowser__Phaeo:GFF2695 102 EPMPGVILGHKNIPVQSVGCYVPGGKFPMVASAHMSVATAKVAGVPRIVACTPPF-NGEPNPAVIAAMHLGGAHEI 176 9*****************************************************6.9******************* PP TIGR00069 151 ykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEvlviadesanpelvaaDllsqa 226 y +GG qa++a+a Gte++ +v +vGPGn++V++AK+++fg+vgid++aGP+E +viad++ ++el+a+Dll qa lcl|FitnessBrowser__Phaeo:GFF2695 177 YVLGGIQAVGAMAIGTESIAPVHLLVGPGNAFVAEAKRQLFGRVGIDLFAGPTETMVIADDTVDAELCATDLLGQA 252 **************************************************************************** PP TIGR00069 227 EHdedaqailvttseelaekveeeveeqleelerkeiaekslekngaiilvddleealelsneyApEHLelqtkdp 302 EH+ ++ a+lvt+s++lae++ +e+++ l+ l+++ +a+ s+e++g++il+d+++e+l++++++A EH++++t+ lcl|FitnessBrowser__Phaeo:GFF2695 253 EHGYNSPAVLVTNSRTLAEDTLKEIDRILTILPTAGTARVSWEDYGEVILCDSYDEMLAVADDIASEHVQVMTDRD 328 **************************************************************************** PP TIGR00069 303 eellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealee.laeavekl 377 +l++++ +G++flG+ t +a gd+v G+nh+LPT+++ r+++gl+v +Flk+ s+q+++++++++ ++e ++l lcl|FitnessBrowser__Phaeo:GFF2695 329 DWFLDNMTCYGALFLGPRTNVANGDKVIGTNHTLPTKKAGRYTGGLWVGKFLKTHSYQKVTSDEAATlIGEYGSRL 404 ************************************************************98877762577889** PP TIGR00069 378 aeaEgLeaHaeavevR 393 + +Eg+ Hae ++R lcl|FitnessBrowser__Phaeo:GFF2695 405 CMLEGFVGHAEQCNIR 420 ***********99988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (442 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 10.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory