Align phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (characterized)
to candidate GFF907 PGA1_c09230 phosphoribosyl-ATP pyrophosphatase HisE
Query= reanno::Korea:Ga0059261_1051 (107 letters) >FitnessBrowser__Phaeo:GFF907 Length = 105 Score = 101 bits (251), Expect = 3e-27 Identities = 52/100 (52%), Positives = 70/100 (70%) Query: 5 ILDTLEAVIRERRTGDPATSYVAKLTAKGRAKIAQKLGEEAVEAAIAAVQDDRDGLTGEA 64 +L LE I R+ DP +S+ AKL AKG K A+K GEEA+EA I AV+D++ GL E Sbjct: 3 LLHDLETTILSRKGADPDSSWTAKLLAKGPEKCAEKFGEEAIEAIIEAVKDNKTGLASEG 62 Query: 65 ADLIFHLLVLLADTGLSLDDVRAELARREGISGIDEKASR 104 AD+++H LV+LA ++LDDV LA R+G+SGI EKA+R Sbjct: 63 ADVLYHFLVMLAARDVALDDVLQVLADRQGLSGIAEKAAR 102 Lambda K H 0.315 0.132 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 46 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 107 Length of database: 105 Length adjustment: 11 Effective length of query: 96 Effective length of database: 94 Effective search space: 9024 Effective search space used: 9024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 40 (20.0 bits)
Align candidate GFF907 PGA1_c09230 (phosphoribosyl-ATP pyrophosphatase HisE)
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03188.hmm # target sequence database: /tmp/gapView.2482.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03188 [M=84] Accession: TIGR03188 Description: histidine_hisI: phosphoribosyl-ATP diphosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-33 100.6 0.0 2.7e-33 100.3 0.0 1.1 1 lcl|FitnessBrowser__Phaeo:GFF907 PGA1_c09230 phosphoribosyl-ATP p Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF907 PGA1_c09230 phosphoribosyl-ATP pyrophosphatase HisE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.3 0.0 2.7e-33 2.7e-33 1 84 [] 4 87 .. 4 87 .. 0.98 Alignments for each domain: == domain 1 score: 100.3 bits; conditional E-value: 2.7e-33 TIGR03188 1 leeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVllaekgvsled 79 l++Le++i +rk +dp++S+takll+kg +k+++K+gEEa+E ii+a++++k+ l++E aD+lYh+lV+la+++v l+d lcl|FitnessBrowser__Phaeo:GFF907 4 LHDLETTILSRKGADPDSSWTAKLLAKGPEKCAEKFGEEAIEAIIEAVKDNKTGLASEGADVLYHFLVMLAARDVALDD 82 789**************************************************************************** PP TIGR03188 80 vlaeL 84 vl++L lcl|FitnessBrowser__Phaeo:GFF907 83 VLQVL 87 **987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (84 nodes) Target sequences: 1 (105 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 2.56 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory