Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate GFF2473 PGA1_c25050 ribose-phosphate pyrophosphokinase Prs
Query= SwissProt::P0A1V6 (315 letters) >FitnessBrowser__Phaeo:GFF2473 Length = 339 Score = 314 bits (805), Expect = 2e-90 Identities = 167/319 (52%), Positives = 222/319 (69%), Gaps = 11/319 (3%) Query: 5 KLFAGNATPELAQRIANRLYTSLG------DAAVGRFSDGEVSVQINENVRGGDIFIIQS 58 KL AGNA LA+ I R+ G DA V RF+DGE+ V++ ENVRG D+FIIQ Sbjct: 8 KLIAGNANLPLAETITRRMSMHRGVDQGLVDARVERFNDGEIFVEVYENVRGEDMFIIQP 67 Query: 59 TCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLS 118 T P NDNLMEL+++ DALRR+SA RITAVIPYFGYARQDRR + AR PI+AK+VA+ L+ Sbjct: 68 TSNPANDNLMELLIIADALRRSSAQRITAVIPYFGYARQDRRTK-ARTPISAKLVANMLT 126 Query: 119 SVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDM---LQLNLDNPIVVSPDIGGVV 175 G++RVLT+DLHA QIQGFFD+PVDN++ SPI D+ + ++D +VVSPD+GGV Sbjct: 127 GAGIERVLTMDLHAAQIQGFFDIPVDNLYASPIFALDVKNQFKDSMDEIMVVSPDVGGVA 186 Query: 176 RARAIAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEA 235 RAR +AK +N ++I+DKRR +A M +IGDV + C+++DDM DT GTLCKAA+ Sbjct: 187 RARELAKRIN-APLSIVDKRREKAGEVAEMTVIGDVTDKICLIIDDMCDTAGTLCKAAQV 245 Query: 236 LKERGAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGM 295 L + GAK V AY TH + SG A + NSV+ +V+ DTI TD + PN+R L + + Sbjct: 246 LLDNGAKEVHAYITHGVMSGPAVERVTNSVMKSLVLTDTIQPTDAVLGAPNIRILPTAPL 305 Query: 296 LAEAIRRISNEESISAMFE 314 +AI I + S+S++FE Sbjct: 306 FTQAILNIWHGTSVSSLFE 324 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 339 Length adjustment: 28 Effective length of query: 287 Effective length of database: 311 Effective search space: 89257 Effective search space used: 89257 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF2473 PGA1_c25050 (ribose-phosphate pyrophosphokinase Prs)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.1568.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-111 356.7 0.2 4.9e-111 356.5 0.2 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2473 PGA1_c25050 ribose-phosphate pyr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2473 PGA1_c25050 ribose-phosphate pyrophosphokinase Prs # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.5 0.2 4.9e-111 4.9e-111 3 309 .] 9 324 .. 7 324 .. 0.94 Alignments for each domain: == domain 1 score: 356.5 bits; conditional E-value: 4.9e-111 TIGR01251 3 ilsgssskelaekvaknlgle......lgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmelllli 72 +++g+++ lae + ++++++ l+d++v++F dgE+ v++ e+vrg+d+fii q ts+p nd+lmell+++ lcl|FitnessBrowser__Phaeo:GFF2473 9 LIAGNANLPLAETITRRMSMHrgvdqgLVDARVERFNDGEIFVEVYENVRGEDMFII-QPTSNPANDNLMELLIIA 83 677888888888887776654333333899***************************.****************** PP TIGR01251 73 dalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspk 148 dal+r+sa+++taviPy+gYaRqd+++k r+pisaklva++l+ aG++rvlt+dlH+ qiqgfFd+pv+nl+asp lcl|FitnessBrowser__Phaeo:GFF2473 84 DALRRSSAQRITAVIPYFGYARQDRRTKARTPISAKLVANMLTGAGIERVLTMDLHAAQIQGFFDIPVDNLYASPI 159 **************************************************************************** PP TIGR01251 149 lieelkkke...lknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiis 221 ++ ++k++ +++++vvsPD G+v+ra+++ak+++++l+i++K+R+ k+ ev + ++gdv +k ++i+DD+ + lcl|FitnessBrowser__Phaeo:GFF2473 160 FALDVKNQFkdsMDEIMVVSPDVGGVARARELAKRINAPLSIVDKRRE-KAGEVAEMTVIGDVTDKICLIIDDMCD 234 ****99988888999*********************************.667************************ PP TIGR01251 222 TggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeai 295 T+gTl+kaa++L ++GAk+v +++thgv+sg+A+er+++++++ ++ t+ti+ + p+++ + apl+ +ai lcl|FitnessBrowser__Phaeo:GFF2473 235 TAGTLCKAAQVLLDNGAKEVHAYITHGVMSGPAVERVTNSVMKSLVLTDTIQPtDAvLGAPNIRILPTAPLFTQAI 310 ***************************************************995557889**************** PP TIGR01251 296 arihenesvsslfd 309 ++i +++svsslf+ lcl|FitnessBrowser__Phaeo:GFF2473 311 LNIWHGTSVSSLFE 324 ************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.98 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory