Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate GFF3342 PGA1_c33950 diaminopimelate epimerase DapF
Query= curated2:Q3IZB6 (279 letters) >FitnessBrowser__Phaeo:GFF3342 Length = 281 Score = 298 bits (763), Expect = 9e-86 Identities = 143/275 (52%), Positives = 193/275 (70%), Gaps = 2/275 (0%) Query: 2 MDMGASSGLGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQ 61 M +G+ + L FMKMHG GNDFVV+D+R + +T +A + R G+GFDQL I Sbjct: 4 MTIGSDTRLPFMKMHGLGNDFVVVDARDQTWD-ITPAMAEGIAHRQMGIGFDQLTVITKG 62 Query: 62 EGADCALDFWNSDGSRSGTCGNATRCVSDYLMRDLGRDEVNLVTARGRLHARRREDGLVA 121 + D L F+N+DGS S CGNATRC++ +L+ + G+ + L T RG L A +GL + Sbjct: 63 D-EDAHLTFYNADGSTSAACGNATRCIARHLLDESGKTHLRLTTDRGLLLAEDAGNGLTS 121 Query: 122 VNMGAPQLLWSEIPLARAMETDSLPLEGTPSAVGMGNPHCIYFVEDAEAVDLAGRGAAVE 181 VNMG PQL W +IPLA ++T LP+EG P+A GMGNPHC +FV++AE + LA GA E Sbjct: 122 VNMGEPQLDWQDIPLAEDVDTLELPIEGAPTATGMGNPHCTFFVDNAEVIPLAEFGARYE 181 Query: 182 TDPLFPERTNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRGLTGRQVRL 241 PL+PERTNV+ A ++ PD LR+RVWERG GITLA GS +CATAVAAARRGLT R+V++ Sbjct: 182 HHPLYPERTNVQVAHVVAPDHLRMRVWERGVGITLASGSSSCATAVAAARRGLTSRKVQI 241 Query: 242 EMDGGVLEVDWRDEGVWLSGPVARVFEGHLSPEMM 276 ++DGG L +DWR +GVW++GP V +GH + + + Sbjct: 242 DLDGGTLWIDWRKDGVWMTGPTMHVADGHFTRQFL 276 Lambda K H 0.321 0.138 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 281 Length adjustment: 26 Effective length of query: 253 Effective length of database: 255 Effective search space: 64515 Effective search space used: 64515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF3342 PGA1_c33950 (diaminopimelate epimerase DapF)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.17078.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-75 238.0 0.0 7.6e-75 237.8 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3342 PGA1_c33950 diaminopimelate epim Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3342 PGA1_c33950 diaminopimelate epimerase DapF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 237.8 0.0 7.6e-75 7.6e-75 3 268 .. 14 271 .. 12 273 .. 0.95 Alignments for each domain: == domain 1 score: 237.8 bits; conditional E-value: 7.6e-75 TIGR00652 3 FlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifNsDGSeaemCGNgiR 78 F+kmhGlgNdFv+vd +d++ + +++++ +++r++g+g+D++ +++ + ++d++l+++N+DGS + CGN+ R lcl|FitnessBrowser__Phaeo:GFF3342 14 FMKMHGLGNDFVVVDARDQTWDIT-PAMAEGIAHRQMGIGFDQLTVIT--KGDEDAHLTFYNADGSTSAACGNATR 86 9*****************888777.9*********************9..5999********************** PP TIGR00652 79 cfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltvekeeekeellalevlvvdvGn 154 c+a+++ ++ +k ++l++ t++gl+ +e ++ +v+mgep++ ++ipl ++ ++ + + + + + +Gn lcl|FitnessBrowser__Phaeo:GFF3342 87 CIARHLLDESGK--THLRLTTDRGLLLAEDAGNG-LTSVNMGEPQLDWQDIPLAEDVDTLELPI-EGAPTATGMGN 158 ***********9..8**************99999.*******************8777774333.334479***** PP TIGR00652 155 PHlvvfvedvekldleelgklleaheefpegvNvefvevkkedeiklrvyERGageTlaCGtGavAsavvalklgk 230 PH+ +fv++ e ++l e g+ e+h+ +pe++Nv++++v+ +d++++rv+ERG+g+Tla G+ ++A+av+a++ g+ lcl|FitnessBrowser__Phaeo:GFF3342 159 PHCTFFVDNAEVIPLAEFGARYEHHPLYPERTNVQVAHVVAPDHLRMRVWERGVGITLASGSSSCATAVAAARRGL 234 **************************************************************************** PP TIGR00652 231 tkkkvtvhleggeLeievkedgkvyltGpavlvlegel 268 t +kv++ l+gg L i++++dg v++tGp +v++g+ lcl|FitnessBrowser__Phaeo:GFF3342 235 TSRKVQIDLDGGTLWIDWRKDG-VWMTGPTMHVADGHF 271 *********************8.************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.66 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory