Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate GFF1666 PGA1_c16890 anthranilate phosphoribosyltransferase TrpD
Query= SwissProt::P83827 (329 letters) >FitnessBrowser__Phaeo:GFF1666 Length = 342 Score = 229 bits (583), Expect = 1e-64 Identities = 137/311 (44%), Positives = 176/311 (56%), Gaps = 9/311 (2%) Query: 13 LEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVHRRP 72 L EEA L G +P + GLL+AL RGE E AA A MR P+ V Sbjct: 17 LSREEAEAAFTQLFEGNATPSQMGGLLMALRTRGETVDEYAAAAAVMRAKCNPV-VAPAG 75 Query: 73 LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAP 132 +DIVGTGGDGKG +N+ST A V A G VAKHGNR SS++G+AD L +G+++ Sbjct: 76 AMDIVGTGGDGKGTLNISTATAFVVAGAGTVVAKHGNRNLSSKSGAADALGQMGINVMVG 135 Query: 133 PERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGV 192 P+ +A+ E G F+ A + HPA+ HV P R ELG RT+FN+LGPLTNPAG + G Sbjct: 136 PKVAEQALREAGICFMMAPMHHPAIAHVMPTRQELGTRTIFNILGPLTNPAGVKRQLTGA 195 Query: 193 FSPEWLAPMAEALERLGA-RGLVVHG-EGADEL-VLGENRVVEVGKGA----YALTPEEV 245 FS + + PMAE L +LG+ + +VHG +G DEL + G + V + G + PE+ Sbjct: 196 FSRDLIRPMAETLGQLGSEQAWLVHGSDGTDELTITGVSWVAALNPGGSVTEMEIHPEDA 255 Query: 246 GLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSLKEGVA 305 GL P EA+ GG PEENA LL GE DAV L + A AG LK G Sbjct: 256 GLSVHPFEAIVGGTPEENAKAFAALLSGEASA-YRDAVLLNSAAALVVAGAASDLKTGAE 314 Query: 306 LAREVLASGEA 316 +AR + SG A Sbjct: 315 MARASIDSGAA 325 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 342 Length adjustment: 28 Effective length of query: 301 Effective length of database: 314 Effective search space: 94514 Effective search space used: 94514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF1666 PGA1_c16890 (anthranilate phosphoribosyltransferase TrpD)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.14209.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-114 367.7 3.7 3.4e-114 367.5 3.7 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1666 PGA1_c16890 anthranilate phospho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1666 PGA1_c16890 anthranilate phosphoribosyltransferase TrpD # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 367.5 3.7 3.4e-114 3.4e-114 6 329 .. 13 334 .. 8 335 .. 0.98 Alignments for each domain: == domain 1 score: 367.5 bits; conditional E-value: 3.4e-114 TIGR01245 6 dnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDivGTGGDg 81 ++ Ls+eeae++++++++g+a+++q++ +l+alr++get++e a++a ++r+k + v + + ++DivGTGGDg lcl|FitnessBrowser__Phaeo:GFF1666 13 AERALSREEAEAAFTQLFEGNATPSQMGGLLMALRTRGETVDEYAAAAAVMRAKCNPVVA--PAGAMDIVGTGGDG 86 5789****************************************************9977..79************ PP TIGR01245 82 lktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPkyhpalke 157 t+NiSTa+a+v+a+aG+ vaKhGnr ssksG+aD L ++g+n+ + p+ ++++l+e gi+F++AP++hpa+++ lcl|FitnessBrowser__Phaeo:GFF1666 87 KGTLNISTATAFVVAGAGTVVAKHGNRNLSSKSGAADALGQMGINVMVGPKVAEQALREAGICFMMAPMHHPAIAH 162 **************************************************************************** PP TIGR01245 158 vapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisltgetkvae 233 v+p+R+eLg+rt+fN+LGPL+nPa +k+q+ G +s+dl++ +ae+l +lg+++a +vhg+dg+DE+++tg + va lcl|FitnessBrowser__Phaeo:GFF1666 163 VMPTRQELGTRTIFNILGPLTNPAGVKRQLTGAFSRDLIRPMAETLGQLGSEQAWLVHGSDGTDELTITGVSWVAA 238 **************************************************************************** PP TIGR01245 234 lkd.geieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegv 308 l+ g+++e++++ped gl ++ e++ gg++eena+++ ++l+g++ +a rd+v+lN aaal+vag+a+dlk g+ lcl|FitnessBrowser__Phaeo:GFF1666 239 LNPgGSVTEMEIHPEDAGLSVHPFEAIVGGTPEENAKAFAALLSGEA-SAYRDAVLLNSAAALVVAGAASDLKTGA 313 *96268**********************************9999999.899************************* PP TIGR01245 309 elakeaiksgkalekleelva 329 e+a+++i+sg+a ek+e+l++ lcl|FitnessBrowser__Phaeo:GFF1666 314 EMARASIDSGAAREKIEALAR 334 ****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory