Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate GFF1663 PGA1_c16860 anthranilate synthase component 1
Query= SwissProt::P20579 (493 letters) >FitnessBrowser__Phaeo:GFF1663 Length = 503 Score = 420 bits (1080), Expect = e-122 Identities = 239/494 (48%), Positives = 319/494 (64%), Gaps = 21/494 (4%) Query: 4 EEFLRLAAVGYNRIPLACETLADFDTPLSIYLKLAD-QPNSYLLESVQGGEKWGRYSMIG 62 + F + G N++ + AD DTP+S+ LKL Q ++++LESV GGE GRYS+IG Sbjct: 8 DTFAKAYEAGENQV-VYTRLAADLDTPVSLMLKLTGAQKDAFILESVTGGEVRGRYSIIG 66 Query: 63 LPSRTVMRVHGYHVSILHDG-VEVESHDVED--PLAFVESFKDRYKVADIPG-LPRFNGG 118 + V R HG ++ + ++ + D PL + K+ D+P LP+ G Sbjct: 67 MKPDLVWRCHGERAALNRSARFDADAFEPLDGNPLDCLRDLIAESKI-DLPDDLPQAAAG 125 Query: 119 LVGYFGYDCVRYVEKRLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPA-- 176 L GY GYD +R VE V NPDPLG+PD L++ + V D + G+ + +V PA Sbjct: 126 LFGYLGYDMIRLVEHLPDV--NPDPLGLPDALMLRPSVIAVLDGVKGE---VTVVSPAWA 180 Query: 177 -----EEQAFEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPEFRSSYTREDYENAVG 231 + A+ Q R+ + L + + P DL P S++T++ Y AV Sbjct: 181 SDGQSAKAAYAQAAERVMDAVRDLERAM-PAESRDLGDADEVAPPV-SNFTKDGYMAAVE 238 Query: 232 RIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPE 291 + K+YI AGD QVVP+QR + F+ P LYR+LR NP+P+M++FNFG F VVG+SPE Sbjct: 239 KAKDYIRAGDIFQVVPAQRWTQTFRQPPFALYRSLRRTNPSPFMFYFNFGGFQVVGASPE 298 Query: 292 VLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVGRVS 351 +LVRV VT+RPIAGTRPRGAT E D+ALE DLL+D KE+AEHLML+DLGRND GRV+ Sbjct: 299 ILVRVFGQEVTIRPIAGTRPRGATPEEDKALELDLLADKKELAEHLMLLDLGRNDTGRVA 358 Query: 352 STGSVRLTEKMVIERYSNVMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAPKIRAMEI 411 G+VR TEK +IERYS+VMHIVSNV G+L E A+DA A +PAGT+SGAPK+RAMEI Sbjct: 359 KIGTVRPTEKFIIERYSHVMHIVSNVVGELAEDKDALDAFFAGMPAGTVSGAPKVRAMEI 418 Query: 412 IDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVINDGELHVQAGGGIVADSVPALEWE 471 IDELEP KRGVYGG VGYF+ G+MD IA+RTA++ D L++QAGGG+V DS P E+ Sbjct: 419 IDELEPEKRGVYGGGVGYFSAGGDMDMCIALRTAIVKDQNLYIQAGGGVVYDSDPEAEYM 478 Query: 472 ETINKRRAMFRAVA 485 ET++K A+ RA A Sbjct: 479 ETVHKSNAIRRAAA 492 Lambda K H 0.320 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 697 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 503 Length adjustment: 34 Effective length of query: 459 Effective length of database: 469 Effective search space: 215271 Effective search space used: 215271 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate GFF1663 PGA1_c16860 (anthranilate synthase component 1)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.5934.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-173 561.5 0.0 9.6e-173 561.3 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1663 PGA1_c16860 anthranilate synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1663 PGA1_c16860 anthranilate synthase component 1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 561.3 0.0 9.6e-173 9.6e-173 2 454 .. 29 491 .. 28 492 .. 0.91 Alignments for each domain: == domain 1 score: 561.3 bits; conditional E-value: 9.6e-173 TIGR00564 2 dtltpisvylklak.rkesfllEsvekeeelgRySliglnpvleikakdgkavlleaddeeak....ieedelkel 72 d tp+s++lkl+ +k f+lEsv+ +e +gRyS+ig++p+l++++++++a l + + +a ++++l+ l lcl|FitnessBrowser__Phaeo:GFF1663 29 DLDTPVSLMLKLTGaQKDAFILESVTGGEVRGRYSIIGMKPDLVWRCHGERAALNRSARFDADafepLDGNPLDCL 104 778***********99********************************99554443332222234579******** PP TIGR00564 73 rkllekaeesedeldeplsggavGylgydtvrlveklkeeaedelelpdlllllvetvivfDhvekkvilienart 148 r+l+++ +++ ++ ++ ++g++Gylgyd++rlve+l++ ++d+l lpd+l+l + ++v D v+ +v++++ a lcl|FitnessBrowser__Phaeo:GFF1663 105 RDLIAESKIDLPDDLPQAAAGLFGYLGYDMIRLVEHLPDVNPDPLGLPDALMLRPSVIAVLDGVKGEVTVVSPAWA 180 ******8766554446689******************************************************999 PP TIGR00564 149 eaers...aeeeaaarleellaelqkelekavkaleekkes...ftsnvekeeyeekvakakeyikaGdifqvvlS 218 ++++s a+++aa+r+ + +++l++++ + + l ++ + sn++k+ y+++v+kak+yi+aGdifqvv++ lcl|FitnessBrowser__Phaeo:GFF1663 181 SDGQSakaAYAQAAERVMDAVRDLERAMPAESRDLGDAD-EvapPVSNFTKDGYMAAVEKAKDYIRAGDIFQVVPA 255 999985555555666666666666666654433222222.23457899999************************* PP TIGR00564 219 qrleakveakpfelYrkLRtvNPSpylyyldledfelvgsSPEllvkvkgkrvetrPiAGtrkRGatkeeDealee 294 qr ++ ++++pf+lYr+LR++NPSp+++y+++ +f++vg+SPE+lv+v g++v++rPiAGtr+RGat+eeD+ale lcl|FitnessBrowser__Phaeo:GFF1663 256 QRWTQTFRQPPFALYRSLRRTNPSPFMFYFNFGGFQVVGASPEILVRVFGQEVTIRPIAGTRPRGATPEEDKALEL 331 **************************************************************************** PP TIGR00564 295 eLladeKerAEHlmLvDLaRNDigkvaklgsvevkellkiekyshvmHivSeVeGelkdeltavDalraalPaGTl 370 +Llad+Ke AEHlmL+DL+RND g+vak+g+v+ +e + ie+yshvmHivS+V+Gel+++++a+Da+ a +PaGT+ lcl|FitnessBrowser__Phaeo:GFF1663 332 DLLADKKELAEHLMLLDLGRNDTGRVAKIGTVRPTEKFIIERYSHVMHIVSNVVGELAEDKDALDAFFAGMPAGTV 407 **************************************************************************** PP TIGR00564 371 sGAPKvrAmelidelEkekRgiYgGavgylsfdgdvdtaiaiRtmvlkdgvayvqAgaGiVaDSdpeaEyeEtlnK 446 sGAPKvrAme+idelE+ekRg+YgG+vgy+s+ gd+d++ia+Rt+++kd+ +y+qAg+G+V+DSdpeaEy Et++K lcl|FitnessBrowser__Phaeo:GFF1663 408 SGAPKVRAMEIIDELEPEKRGVYGGGVGYFSAGGDMDMCIALRTAIVKDQNLYIQAGGGVVYDSDPEAEYMETVHK 483 **************************************************************************** PP TIGR00564 447 akallrai 454 ++a ra+ lcl|FitnessBrowser__Phaeo:GFF1663 484 SNAIRRAA 491 ***99985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (503 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.96 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory