Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate 6936706 Sama_0893 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq)
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__SB2B:6936706 Length = 363 Score = 452 bits (1164), Expect = e-132 Identities = 219/354 (61%), Positives = 275/354 (77%) Query: 1 MQKDALNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCG 60 MQ+D +NNVHI+ E+VL+TP++LK PLS I SR++++DI+ RDPRLLVV G Sbjct: 1 MQQDTINNVHISAEKVLITPQELKRELPLSEHGYQYILRSRRTVADIVHKRDPRLLVVAG 60 Query: 61 PCSIHDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDV 120 PCSIHD A EYA + K L E+ D +++MRVYFEKPRTTVGWKG+INDP MD SFDV Sbjct: 61 PCSIHDIAAAKEYALKLKKLHDELKDEFFILMRVYFEKPRTTVGWKGMINDPDMDESFDV 120 Query: 121 EAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL 180 E GL++AR+L++ L + LP+ATEALDP SPQY+ +L +WSAIGARTTESQTHREMASGL Sbjct: 121 EKGLRLARELMIFLAELELPVATEALDPISPQYISELVTWSAIGARTTESQTHREMASGL 180 Query: 181 SMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKAP 240 SMPVGFKNGTDG L AINAM++AA HRF+GINQ GQVALLQT GNPDGH+ILRGG P Sbjct: 181 SMPVGFKNGTDGKLDVAINAMKSAASGHRFMGINQQGQVALLQTNGNPDGHIILRGGSKP 240 Query: 241 NYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGL 300 NY VA+CE ++ AGL P L++DCSHGNS+KD+ RQ V V AQ+ G+ +IIG+ Sbjct: 241 NYDAESVAECEAQVRWAGLDPKLVIDCSHGNSSKDHNRQDPVCRDVFAQVAAGSDAIIGV 300 Query: 301 MIESNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTAR 354 M+ES+++ GNQ ++P SE+KYGVSVTDACI W+ T+ LLRE ++L + +R Sbjct: 301 MLESHLNAGNQPCDKPLSELKYGVSVTDACIDWQTTETLLREGAENLASVIPSR 354 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 363 Length adjustment: 29 Effective length of query: 327 Effective length of database: 334 Effective search space: 109218 Effective search space used: 109218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 6936706 Sama_0893 (phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq))
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.28206.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-156 506.1 0.0 2.1e-156 505.9 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6936706 Sama_0893 phospho-2-dehydro-3-de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6936706 Sama_0893 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 505.9 0.0 2.1e-156 2.1e-156 4 338 .. 10 347 .. 4 351 .. 0.96 Alignments for each domain: == domain 1 score: 505.9 bits; conditional E-value: 2.1e-156 TIGR00034 4 rivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaeklkd 80 +i + + l+tP+elk++ pl+e+ + + +sr+++adi++ +d+rllvv GPcsihd aa+eya +lkkl ++lkd lcl|FitnessBrowser__SB2B:6936706 10 HISAEKVLITPQELKRELPLSEHGYQYILRSRRTVADIVHKRDPRLLVVAGPCSIHDIAAAKEYALKLKKLHDELKD 86 344446688******************************************************************** PP TIGR00034 81 dleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllswgai 157 ++ i+mrvyfekPrttvGWkG+indPd++esfdv+kGlr+ar+l++ l+el+lp+ate+ld+ispqy+++l++w+ai lcl|FitnessBrowser__SB2B:6936706 87 EFFILMRVYFEKPRTTVGWKGMINDPDMDESFDVEKGLRLARELMIFLAELELPVATEALDPISPQYISELVTWSAI 163 ***************************************************************************** PP TIGR00034 158 GarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGkkp 234 Garttesq+hre+asgls+pvgfkngtdG+l vai+a+++aa+ h+f++++++Gqva+++t+Gn+dghiilrGG kp lcl|FitnessBrowser__SB2B:6936706 164 GARTTESQTHREMASGLSMPVGFKNGTDGKLDVAINAMKSAASGHRFMGINQQGQVALLQTNGNPDGHIILRGGSKP 240 ***************************************************************************** PP TIGR00034 235 nydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl...k 308 nydae+vae++++++ agl ++l+id+shgns+kd++rq v+++v +q+a G++aiiGvm+es+l+ Gnq lcl|FitnessBrowser__SB2B:6936706 241 NYDAESVAECEAQVRWAGLDPKLVIDCSHGNSSKDHNRQDPVCRDVFAQVAAGSDAIIGVMLESHLNAGNQPCdkpL 317 ***********************************************************************993233 PP TIGR00034 309 eelkyGksvtdacigwedteallrklaeav 338 +elkyG+svtdaci+w++te+llr+ ae++ lcl|FitnessBrowser__SB2B:6936706 318 SELKYGVSVTDACIDWQTTETLLREGAENL 347 5789********************988776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.41 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory