Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate SMc00696 SMc00696 3-dehydroquinate synthase
Query= BRENDA::Q3M4V2 (363 letters) >FitnessBrowser__Smeli:SMc00696 Length = 377 Score = 278 bits (710), Expect = 2e-79 Identities = 160/364 (43%), Positives = 220/364 (60%), Gaps = 9/364 (2%) Query: 5 INVNLPTQSYEIAIAPASLDQIGQSLAGLKLGKKVLLVSNPTIFKHFGKVAVDSLEAAGF 64 + V+L +SY+I I P + G+ +A G+K+ ++++ + + + + SL +G Sbjct: 13 VRVDLAERSYDILIGPGLIAAAGKEIASRLKGRKMAVITDENVAPRYLEPLMASLGESGI 72 Query: 65 QVASYCLPAGERYKTLNSIQKLYDIALENRLERSSTMVALGGGVIGDMTGFAAATWLRGI 124 + S LPAGE+ K+ + + + L R+ER+ ++ALGGGVIGD+TGFAA RG Sbjct: 73 EAVSLILPAGEKTKSFEHLIPVCEAILGARIERNDAVIALGGGVIGDLTGFAAGIVRRGS 132 Query: 125 NVVQVPTTLLAMVDSAIGGKTGVNHPHGKNLIGAFHQPRFVLIDPQVLKTLPVREFRAGM 184 +Q+PT+LLA VDS++GGKTG+N HGKNLIG FHQP VL D L TL REFRAG Sbjct: 133 RFIQIPTSLLAQVDSSVGGKTGINSAHGKNLIGVFHQPDLVLADTAALDTLSPREFRAGY 192 Query: 185 AEVIKYGVIWDAELFNQLEQSKRLDQLRYIKPELMDAILTRSCQAKADVVGKDEKEGGLR 244 AEV KYG+I E F LE K + P ++AI SCQAKADVV DE+E G R Sbjct: 193 AEVAKYGLIDKPEFFEWLE--KNWQAVFAGGPARIEAIAV-SCQAKADVVAADERENGRR 249 Query: 245 AILNYGHTVGHAVESLTNY--RLLKHGEAVGIGMVAAGQIAVNLGLWQQADADRQNALIE 302 A+LN GHT GHA+E+ T+Y + L HGE V IGMV A + + + L DA R A ++ Sbjct: 250 ALLNLGHTFGHALEAATDYDSKRLVHGEGVAIGMVLAHEFSARMNLASPDDARRVEAHLK 309 Query: 303 KAGLPTKL---PAGL-DIEGIIEALQLDKKVKDGKVRFVLPTQIGVVTVTDEVTSDHIRQ 358 GLPT+L P L + ++EA+ DKKVK GK+ F+L IG V D+V S + Sbjct: 310 TVGLPTRLADIPGALPPADRLMEAIAQDKKVKGGKLTFILTRGIGQSFVADDVPSSEVLS 369 Query: 359 VLQQ 362 L + Sbjct: 370 FLTE 373 Lambda K H 0.319 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 377 Length adjustment: 30 Effective length of query: 333 Effective length of database: 347 Effective search space: 115551 Effective search space used: 115551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate SMc00696 SMc00696 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.16566.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-111 356.3 0.0 1e-110 356.1 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc00696 SMc00696 3-dehydroquinate syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc00696 SMc00696 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.1 0.0 1e-110 1e-110 1 341 [. 22 369 .. 22 372 .. 0.97 Alignments for each domain: == domain 1 score: 356.1 bits; conditional E-value: 1e-110 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklld 73 y++ +g gl++++ +e+a+ k +k+ vitde+v+ + e l + l + g+e+ l++p+ge++Ks+e++ + + lcl|FitnessBrowser__Smeli:SMc00696 22 YDILIGPGLIAAAGKEIASrlKGRKMAVITDENVAPRYLEPLMASLGESGIEAVSLILPAGEKTKSFEHLIPVCE 96 6899*******999999997666*********************99999************************** PP TIGR01357 74 qlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPk 148 ++l + +er+++++a+GGGv+gDl+GF+A + RG r++q+PT+lla+vDssvGGKtgin ++gkNliG f+qP+ lcl|FitnessBrowser__Smeli:SMc00696 97 AILGARIERNDAVIALGGGVIGDLTGFAAGIVRRGSRFIQIPTSLLAQVDSSVGGKTGINSAHGKNLIGVFHQPD 171 *************************************************************************** PP TIGR01357 149 aVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDek 223 +Vl d++ l tl+ re+r+G+aEv K+gli e+fe+lekn++++ a e+i+ s++ Ka+vV++De+ lcl|FitnessBrowser__Smeli:SMc00696 172 LVLADTAALDTLSPREFRAGYAEVAKYGLIDKPEFFEWLEKNWQAVFA--GGPARIEAIAVSCQAKADVVAADER 244 ********************************************8884..679999******************* PP TIGR01357 224 esglRalLNfGHtlgHaiEallkyk...lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkk 295 e+g RalLN+GHt+gHa+Ea+++y+ l HGe VaiGmv++ ++s ++ l+++++++r++a lk++glpt+l + lcl|FitnessBrowser__Smeli:SMc00696 245 ENGRRALLNLGHTFGHALEAATDYDskrLVHGEGVAIGMVLAHEFSARMNLASPDDARRVEAHLKTVGLPTRLAD 319 ************************99999********************************************** PP TIGR01357 296 ....klsveellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 ++ l++a+ +DKK +g+k++++l + iG+ ++a++v+++e+l+ lcl|FitnessBrowser__Smeli:SMc00696 320 ipgaLPPADRLMEAIAQDKKVKGGKLTFILTRGIGQSFVADDVPSSEVLS 369 99987899***********************************9999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.39 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory