Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate Synpcc7942_2122 Synpcc7942_2122 carbamoyl phosphate synthase small subunit
Query= SwissProt::Q9LVW7 (430 letters) >FitnessBrowser__SynE:Synpcc7942_2122 Length = 391 Score = 370 bits (950), Expect = e-107 Identities = 182/368 (49%), Positives = 253/368 (68%), Gaps = 4/368 (1%) Query: 58 ARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTG 117 A LVL DGS++ + GA GT I E+VFNT +TGYQE+LTDPSY GQ V T P++GNTG Sbjct: 19 ALLVLADGSVFHGYACGAAGTVIGEVVFNTGMTGYQEVLTDPSYCGQIVSFTYPELGNTG 78 Query: 118 VNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLRE 177 VNP+DEES + ++GL+ RN++ SNWR ++L DYL + +I+G+Y +DTRA+T+ LR Sbjct: 79 VNPEDEESARPQVSGLIARNVARRHSNWRADRSLPDYLQQHNIVGIYGIDTRALTQHLRS 138 Query: 178 DGSLIGVLSTEQSKTDDELLQMSRSWDIVGIDLISDVSCKSPYEWVDKTNAEWDFNTNSR 237 G++ G +ST ++ ++ + + G++L+ V+ PYEW T+ W+F Sbjct: 139 TGAMNGGISTTILDPEELWAEVKAAPSMEGLNLVDQVTTDRPYEWQTPTSQTWEF-IEGP 197 Query: 238 DGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNGPGDPSA 297 +S V+A DFG+K+NILRRL+SYGC++ VVP+ P E L+ PDG+ SNGPGDP+ Sbjct: 198 TTESLTVVAIDFGVKRNILRRLASYGCRVIVVPADTPIEEILRHEPDGVFLSNGPGDPAT 257 Query: 298 VPYAVETVKELLGK-VPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNRTGQVEI 356 V + T + LL +P++GIC+GHQ+LG ALG +TFK+KFGH G NHP + QVEI Sbjct: 258 VKNGISTAQALLQTGLPLFGICLGHQILGLALGAQTFKLKFGHRGLNHPC--GLSQQVEI 315 Query: 357 SAQNHNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPHDSDNAF 416 ++QNH +A+ SL VEVTH+NLND + AGL + V S+QYHPEASPGPHDSD F Sbjct: 316 TSQNHGFAIAADSLGPDVEVTHLNLNDRTVAGLRHRHLPVFSVQYHPEASPGPHDSDYLF 375 Query: 417 REFIELMK 424 +F+ LM+ Sbjct: 376 EQFVALMR 383 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 391 Length adjustment: 31 Effective length of query: 399 Effective length of database: 360 Effective search space: 143640 Effective search space used: 143640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Synpcc7942_2122 Synpcc7942_2122 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.27455.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-157 510.6 0.0 1.2e-157 510.4 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2122 Synpcc7942_2122 carbamoyl phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2122 Synpcc7942_2122 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 510.4 0.0 1.2e-157 1.2e-157 1 360 [. 19 383 .. 19 384 .. 0.97 Alignments for each domain: == domain 1 score: 510.4 bits; conditional E-value: 1.2e-157 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a lvl+dG+vf+g++ ga ++v+GevvFnT+mtGYqE+ltDpsY gqiv +typ++gn+gvn+ed+es lcl|FitnessBrowser__SynE:Synpcc7942_2122 19 ALLVLADGSVFHGYACGAAGTVIGEVVFNTGMTGYQEVLTDPSYCGQIVSFTYPELGNTGVNPEDEESA 87 579****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeel 138 +++v+gl+ ++++++ sn+ra +sL ++l++++iv+i+g+DTRal+++lR++g+m++ ist+ + eel lcl|FitnessBrowser__SynE:Synpcc7942_2122 88 RPQVSGLIARNVARRHSNWRADRSLPDYLQQHNIVGIYGIDTRALTQHLRSTGAMNGGISTTILDPEEL 156 ********************************************************************* PP TIGR01368 139 vekakespkvkevnlvkevstkeayeleq...k....akkegkk.lrvvvidlGvKenilreLvkrgve 199 +++k++p+++++nlv++v+t+++ye+++ + ++ +++ l+vv+id+GvK+nilr+L+++g++ lcl|FitnessBrowser__SynE:Synpcc7942_2122 157 WAEVKAAPSMEGLNLVDQVTTDRPYEWQTptsQtwefIEGPTTEsLTVVAIDFGVKRNILRRLASYGCR 225 ****************************977625556444444449*********************** PP TIGR01368 200 vtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgakty 268 v+vvpadt++eei + +pdg++lsnGPGdPa+v++ i+t ++ll++ +P+fGIclGhq+l+lalga+t+ lcl|FitnessBrowser__SynE:Synpcc7942_2122 226 VIVVPADTPIEEILRHEPDGVFLSNGPGDPATVKNGISTAQALLQTGLPLFGICLGHQILGLALGAQTF 294 ********************************************************************* PP TIGR01368 269 klkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQy 337 klkfGhrG Nhp+ +++veitsqNHg+a+ +sl ++evth nlnD tv+gl+h++lpvfsvQy lcl|FitnessBrowser__SynE:Synpcc7942_2122 295 KLKFGHRGLNHPCG--LSQQVEITSQNHGFAIAADSLGP-DVEVTHLNLNDRTVAGLRHRHLPVFSVQY 360 *************9..799*****************775.5**************************** PP TIGR01368 338 HPeaspGphdteylFdefvelik 360 HPeaspGphd++ylF++fv l++ lcl|FitnessBrowser__SynE:Synpcc7942_2122 361 HPEASPGPHDSDYLFEQFVALMR 383 *******************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory