Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (uncharacterized)
to candidate Synpcc7942_2467 Synpcc7942_2467 shikimate 5-dehydrogenase
Query= curated2:Q8YVC1 (289 letters) >FitnessBrowser__SynE:Synpcc7942_2467 Length = 288 Score = 318 bits (816), Expect = 7e-92 Identities = 161/287 (56%), Positives = 209/287 (72%), Gaps = 3/287 (1%) Query: 2 ITGKTKLLGVIGHPVEHSLSPVMHNAAIAQLGLDYVYLPFPIAPDNLEAAIALLATIGVV 61 +TG+T+LLG+IG P+EHSLSP++ NAAIA+LGLDY Y+PFP+ +L A+A LA IGV Sbjct: 4 LTGRTRLLGIIGDPIEHSLSPLIQNAAIAELGLDYCYVPFPVKGADLATALAGLAAIGVQ 63 Query: 62 GFSVTIPHKQAIIPLLSEISPVAQAIGAVNTVTRQNNQWVGTNTDIEGFIAPLQTTYKRD 121 GF+VTIPHKQA++PLLS++S +AQ++G+VNTV + WVGTNTD+ GF+APLQ T + D Sbjct: 64 GFNVTIPHKQAVMPLLSQVSELAQSVGSVNTVWQTEQGWVGTNTDVLGFLAPLQ-TLRSD 122 Query: 122 WSQQIAVILGNGGAARAVVAGCYQLGFAEIHVVGRNVQRLEEFRHSWENSPIAENLQVHT 181 WS V+LG GGAARAVVAGC QLG + I V R+ Q+ + F+ SW + A++L +H Sbjct: 123 WSGCRVVLLGCGGAARAVVAGCLQLGCSAIATVVRDAQKGDAFQQSWGDR--ADSLTIHD 180 Query: 182 WDYLAKLIPQANLLVNTTPIGMYPQVDESPLSAEELVNLQTGTIAYDLIYIPKPTQFLQK 241 W + ++ A+L+VNTTP+GM P ++ SPL L+ TIAYDLIY P PT+FLQ+ Sbjct: 181 WSDIPDVLSTADLVVNTTPLGMDPHIERSPLDNSAAQQLRPETIAYDLIYTPSPTRFLQQ 240 Query: 242 AQQQGAIIIDGLEMLVQQGVAALKIWLQQDDIPVDVMRQALIKHLGL 288 A QG IDGLEMLVQQG A LKIW + +PVD MR L HLGL Sbjct: 241 AIAQGCHAIDGLEMLVQQGAAGLKIWTGAEAVPVDTMRSVLNAHLGL 287 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 288 Length adjustment: 26 Effective length of query: 263 Effective length of database: 262 Effective search space: 68906 Effective search space used: 68906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Synpcc7942_2467 Synpcc7942_2467 (shikimate 5-dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.27278.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-67 211.7 0.0 6.5e-67 211.5 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2467 Synpcc7942_2467 shikimate 5-dehy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2467 Synpcc7942_2467 shikimate 5-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 211.5 0.0 6.5e-67 6.5e-67 2 269 .. 10 285 .. 9 286 .. 0.90 Alignments for each domain: == domain 1 score: 211.5 bits; conditional E-value: 6.5e-67 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 llg+iG+pi+hS+spli+naa+++lgl++ Y+ f+v+ +l al g+ a g++G+nvT+P+K++v++l lcl|FitnessBrowser__SynE:Synpcc7942_2467 10 LLGIIGDPIEHSLSPLIQNAAIAELGLDYCYVPFPVKGADLATALAGLAAIGVQGFNVTIPHKQAVMPL 78 68******************************************************************* PP TIGR00507 71 lDeieesakligavNTlkledgklvgynTDgiGlvssLeklsklksekrvliiGAGGaakavaleLlka 139 l +++e a+ +g+vNT+ + vg nTD++G+++ L+ l s+ rv+++G GGaa+av+ l+ lcl|FitnessBrowser__SynE:Synpcc7942_2467 79 LSQVSELAQSVGSVNTVWQTEQGWVGTNTDVLGFLAPLQTLRSDWSGCRVVLLGCGGAARAVVAGCLQL 147 ******************98889*****************988888**********************9 PP TIGR00507 140 dk.eviiaNRtvekaeelaerlqe.lgeilalsleeve..lkkvdliinatsaglsgeideaevka... 201 ++ ++ + R +k+ + + + + + ++++ l++ dl++n+t++g+ ++i+ ++++ lcl|FitnessBrowser__SynE:Synpcc7942_2467 148 GCsAIATVVRDAQKGDAFQQSWGDrADSLTIHDWSDIPdvLSTADLVVNTTPLGMDPHIERSPLDNsaa 216 872577889**9***8887776654555555566677633567****************9999976111 PP TIGR00507 202 ellkegklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgve.pdvekvfealkekl 269 + l+ +++++Dl+y p t +l+ a +g++ idGl+Mlv+Q+a ++wtg e +v+ ++++l+++l lcl|FitnessBrowser__SynE:Synpcc7942_2467 217 QQLRPETIAYDLIYTPSPTRFLQQAIAQGCHAIDGLEMLVQQGAAGLKIWTGAEaVPVDTMRSVLNAHL 285 5678899**********************************************9889999999988766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (288 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.32 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory