Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate Synpcc7942_B2623 Synpcc7942_B2623 cysteine synthase A
Query= BRENDA::P9WP55 (310 letters) >FitnessBrowser__SynE:Synpcc7942_B2623 Length = 329 Score = 315 bits (807), Expect = 9e-91 Identities = 158/309 (51%), Positives = 215/309 (69%), Gaps = 2/309 (0%) Query: 3 IAEDITQLIGRTPLVRLRRVTD--GAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGL 60 I +T+ IG TPLVRL+ GA+A+++ KLE+ NP SVKDR ++++Q+A GL Sbjct: 4 ILNRLTEWIGNTPLVRLQETAQQYGAIAEVLLKLEYLNPLGSVKDRTALSLIQSARSQGL 63 Query: 61 IKPDTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGAD 120 I T ++EPT+GNTGI LA AA R +L MP+ +S ER L + GA+++LTP A+ Sbjct: 64 ITAGTTLIEPTTGNTGIGLAFAAAAEQLRLILVMPDRVSAERIRLAKLLGAKVVLTPAAE 123 Query: 121 GMSGAIAKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTG 180 M G IAKA+ L + + QQF+NPANP+IH+ TT E+WRDTDG+VDIVVAGVGTG Sbjct: 124 AMLGCIAKAQALQQQIPDSVILQQFQNPANPSIHQATTGPEIWRDTDGEVDIVVAGVGTG 183 Query: 181 GTITGVAQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEI 240 GT+ G+++ +K +P + +AV+PA SPVLSGG G H + G+G FV P++D+ L+DEI Sbjct: 184 GTLMGISRYLKPLRPRLQSIAVQPARSPVLSGGAAGSHQLTGMGPNFVSPLVDRSLIDEI 243 Query: 241 ITVGNEDALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYL 300 ++ EDA+ V R A EG+ +G+SSGA AALQVA+RPENAGK IV V P ERYL Sbjct: 244 LSAYEEDAIAVIRTCAAREGIPLGVSSGAIVWAALQVAKRPENAGKRIVAVCPSGSERYL 303 Query: 301 STPLFADVA 309 S+ L AD++ Sbjct: 304 SSTLLADIS 312 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 329 Length adjustment: 28 Effective length of query: 282 Effective length of database: 301 Effective search space: 84882 Effective search space used: 84882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Synpcc7942_B2623 Synpcc7942_B2623 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.17945.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-118 380.0 0.0 4.4e-118 379.8 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_B2623 Synpcc7942_B2623 cysteine syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_B2623 Synpcc7942_B2623 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.8 0.0 4.4e-118 4.4e-118 2 297 .. 9 307 .. 8 308 .. 0.98 Alignments for each domain: == domain 1 score: 379.8 bits; conditional E-value: 4.4e-118 TIGR01139 2 seliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsG 66 +e iGntPlvrL+ + +a aevl+kle+lnP +svkdr+al++i++a +gl++ g+t++e+t G lcl|FitnessBrowser__SynE:Synpcc7942_B2623 9 TEWIGNTPLVRLQetaQQYGAIAEVLLKLEYLNPLGSVKDRTALSLIQSARSQGLITAGTTLIEPTTG 76 689*********97545567789********************************************* PP TIGR01139 67 ntGialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkyl 134 ntGi+la+ aaa ++lil+mp+ +s er +l k +Ga++vLt++ae m g+i+ka+ l ++ p++ lcl|FitnessBrowser__SynE:Synpcc7942_B2623 77 NTGIGLAFAAAAEQLRLILVMPDRVSAERIRLAKLLGAKVVLTPAAEAMLGCIAKAQALQQQIPDSV- 143 ****************************************************************887. PP TIGR01139 135 llkqfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaesp 202 +l+qf+npanp+ih++tt+pei++d+dg++d++vagvGtGGt+ G++++lk +p ++++av Pa+sp lcl|FitnessBrowser__SynE:Synpcc7942_B2623 144 ILQQFQNPANPSIHQATTGPEIWRDTDGEVDIVVAGVGTGGTLMGISRYLKPLRPRLQSIAVQPARSP 211 ******************************************************************** PP TIGR01139 203 vlsggkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalk 270 vlsgg +g+h++ G+g++f+ +d+++ide+++ +e+ai++ r a++eGi G+ssGa v+aal+ lcl|FitnessBrowser__SynE:Synpcc7942_B2623 212 VLSGGAAGSHQLTGMGPNFVSPLVDRSLIDEILSAYEEDAIAVIRTCAAREGIPLGVSSGAIVWAALQ 279 ******************************************************************** PP TIGR01139 271 vakkle.kdkkivvilpdtgerYlstaL 297 vak++e ++k+iv++ p+ +erYls +L lcl|FitnessBrowser__SynE:Synpcc7942_B2623 280 VAKRPEnAGKRIVAVCPSGSERYLSSTL 307 ******9******************887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.06 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory