Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate Synpcc7942_1029 Synpcc7942_1029 branched-chain amino acid aminotransferase
Query= BRENDA::P54691 (305 letters) >FitnessBrowser__SynE:Synpcc7942_1029 Length = 304 Score = 457 bits (1177), Expect = e-133 Identities = 219/303 (72%), Positives = 260/303 (85%) Query: 1 MHKFLPIAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHG 60 M+ FLP A+F + VPF +A++S+ATHALHYGT AFGGLRGIPDPE+P +LLFRLDRH Sbjct: 1 MNDFLPYAFFRGQLVPFPEAQLSIATHALHYGTGAFGGLRGIPDPENPDRVLLFRLDRHC 60 Query: 61 DRLSKSAKFLHYDISAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDF 120 RLS+SAKFLH+++SAE+I + I FV+KNQP +SFYIRP VY+S LGIAPRLHN+EKDF Sbjct: 61 QRLSQSAKFLHFELSAEEIFKAIEAFVQKNQPSQSFYIRPFVYTSDLGIAPRLHNIEKDF 120 Query: 121 LVYGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 +YGL++GDYL+ +GVSCRISSWYRQEDRS PLRGKIS AYI S+LAKTEAV SGFDEAI Sbjct: 121 FIYGLQLGDYLSPEGVSCRISSWYRQEDRSLPLRGKISGAYIASSLAKTEAVASGFDEAI 180 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 LMNSQGKVCEATGMN+FMVRNG+++TPG +QDILEGITRDS++ +A DLGIP QRPIDK Sbjct: 181 LMNSQGKVCEATGMNLFMVRNGRLITPGYDQDILEGITRDSVIRVAQDLGIPVDQRPIDK 240 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDRPITEKLRSVLTAVTENREPKYQDWVFK 300 SEL IADEVFLSGTAAK+TPVK++EN+ DRPIT+++R LT +TE R YQDWVF Sbjct: 241 SELFIADEVFLSGTAAKVTPVKQVENYLTPCDRPITDQIRQQLTLITEGRLAAYQDWVFP 300 Query: 301 IPL 303 I L Sbjct: 301 IAL 303 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 304 Length adjustment: 27 Effective length of query: 278 Effective length of database: 277 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Synpcc7942_1029 Synpcc7942_1029 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.1517.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-82 261.3 0.0 6.1e-82 261.1 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_1029 Synpcc7942_1029 branched-chain a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_1029 Synpcc7942_1029 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 261.1 0.0 6.1e-82 6.1e-82 1 296 [. 9 299 .. 9 301 .. 0.94 Alignments for each domain: == domain 1 score: 261.1 bits; conditional E-value: 6.1e-82 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdk...glaifrlkehveRlydsakilrleipys 66 ++ G+lv++ +a++++ thalhYGtg f G+R ++ +frl+ h++Rl +sak l++e +s lcl|FitnessBrowser__SynE:Synpcc7942_1029 9 FFRGQLVPFPEAQLSIATHALHYGTGAFGGLRGIPDPEnpdRVLLFRLDRHCQRLSQSAKFLHFE--LS 75 789*****************************9865542327789***************98876..68 PP TIGR01122 67 keelvevtkevlrknnlks.aYiRplvyvGaedlglkpk.vdlkveviiaawewgaylgeealekGikv 133 +ee+ +++ ++kn+ ++ YiRp vy + dlg+ p+ +++ + +i+ ++g yl +G++ lcl|FitnessBrowser__SynE:Synpcc7942_1029 76 AEEIFKAIEAFVQKNQPSQsFYIRPFVY--TSDLGIAPRlHNIEKDFFIYGLQLGDYLSP----EGVSC 138 9*************9976659*******..89*******999*****************7....6**** PP TIGR01122 134 kvssfrraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltP 202 ++ss+ r+++ s+p + k +g+Y+ s lak+ea+++G+deail++++G v e +G n+f+v++g l+tP lcl|FitnessBrowser__SynE:Synpcc7942_1029 139 RISSWYRQEDRSLPLRGKISGAYIASSLAKTEAVASGFDEAILMNSQGKVCEATGMNLFMVRNGRLITP 207 ********************************************************************* PP TIGR01122 203 pvsesiLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGp 271 + iL+gitrd+vi++a++lgi v +++i ++el++aDevfl+Gtaa vtP+++v++ + p lcl|FitnessBrowser__SynE:Synpcc7942_1029 208 GYDQDILEGITRDSVIRVAQDLGIPVDQRPIDKSELFIADEVFLSGTAAKVTPVKQVENYLTPCDR--P 274 **********************************************************98766554..9 PP TIGR01122 272 vtkklqeaffdlvegktekkeewlt 296 +t +++++ ++eg+ ++++w+ lcl|FitnessBrowser__SynE:Synpcc7942_1029 275 ITDQIRQQLTLITEGRLAAYQDWVF 299 **********************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory