Align Anthranilate synthase component 2; AS; ASII; EC 4.1.3.27; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component (uncharacterized)
to candidate Synpcc7942_0189 Synpcc7942_0189 bifunctional GMP synthase/glutamine amidotransferase protein
Query= curated2:Q57690 (197 letters) >FitnessBrowser__SynE:Synpcc7942_0189 Length = 575 Score = 76.3 bits (186), Expect = 1e-18 Identities = 50/165 (30%), Positives = 86/165 (52%), Gaps = 11/165 (6%) Query: 31 KLVDNKITLDEIKKINPDRIIISPGPKTPKE--AGNCIKIIQEVDIPILGVCLGHQCIVE 88 +++ + T D+I++++P II+S GP + + A C I + IP+LGVC G Q +V+ Sbjct: 87 EVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAPVCDPEIWNLGIPVLGVCYGMQLMVQ 146 Query: 89 AFGGEVGRAKRVMHGKASLINHDGEGIFKDIPNPFYGGRYHSLIAKEVPKELKITAKSLD 148 GG+V RA+R +GKA+L+ D + ++ H K +P+ ++ A + D Sbjct: 147 QLGGQVDRAERGEYGKAALVIDDPTDLLTNVEPGSTMWMSHGDSVKTMPEGFELLAHT-D 205 Query: 149 DNYIMGVRHKKLPIEGVQFHPESILTESDNLKFPDLGLKLIKNFV 193 + + + GVQFHPE + + G+ LI+NFV Sbjct: 206 NTPCAAIADHQRKFYGVQFHPEVVHSVH--------GMALIRNFV 242 Lambda K H 0.319 0.142 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 197 Length of database: 575 Length adjustment: 28 Effective length of query: 169 Effective length of database: 547 Effective search space: 92443 Effective search space used: 92443 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory