Align Anthranilate phosphoribosyltransferase 2; EC 2.4.2.18 (characterized)
to candidate Synpcc7942_2123 Synpcc7942_2123 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8YXQ9 (362 letters) >FitnessBrowser__SynE:Synpcc7942_2123 Length = 348 Score = 399 bits (1025), Expect = e-116 Identities = 210/344 (61%), Positives = 259/344 (75%), Gaps = 10/344 (2%) Query: 17 LLLQQLIDGESLSRSQAAELMQGWLSEAVPPELSGAILTALNFKGVSADELTGMAEVLQS 76 +LLQ+L++ ESL QA LM+ WLS +P LSGA+L AL KGVSA EL MA+VLQ Sbjct: 13 VLLQRLLNHESLGAVQARALMEQWLSGTLPEALSGALLAALQSKGVSAQELAAMAQVLQE 72 Query: 77 QSKMGTGENYSQLPITNSPFSIIDTCGTGGDGSSTFNISTAVAFVAAAYGVPVAKHGNRS 136 Q+ + + ++DTCGTGGDG+ TFNISTAVAFV AA GV VAKHGNRS Sbjct: 73 QAVAVEASDRRE--------PLVDTCGTGGDGAETFNISTAVAFVTAAAGVKVAKHGNRS 124 Query: 137 ASSLTGSADVLEALGVNLGASPEKVQAALQEVGITFLFAPGWHPALKAVATLRRTLRIRT 196 AS GSADVLEALG+NL A +++ AA+ EVGITFLFAPGWHPA+KAVA LR+ L +RT Sbjct: 125 ASGRVGSADVLEALGLNLTAPSDRIHAAVDEVGITFLFAPGWHPAMKAVAPLRKILGVRT 184 Query: 197 VFNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGRERLDEAGLGDLT 256 VFNLLGPLVNPLRPTGQV+G++ P LL T++ AL LG ++AIVLHGRE LDE GL D T Sbjct: 185 VFNLLGPLVNPLRPTGQVIGVYNPGLLPTISGALAELGVRRAIVLHGREGLDEGGLADCT 244 Query: 257 DLAVLSDGELQLTTINPQEVGVTPAPIGALRGGDVQENAEILKAVLQGKGTQAQQDAVAL 316 DLA++ +G+L ++P+++G+T AP AL+GG V+ENA+ILKAVLQGKGT+AQQDAV L Sbjct: 245 DLAIVREGQLSQQVVDPRDLGLTQAPTVALKGGSVEENADILKAVLQGKGTRAQQDAVLL 304 Query: 317 NAALALQVAGAVPLLDHAQGVSVAKEILQTGTAWAKLAQLVYFL 360 NAALAL+V V LD QG+S+A+ +L +G AW KL QL FL Sbjct: 305 NAALALEVGEQVDRLD--QGISLARSVLASGAAWQKLTQLAAFL 346 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 348 Length adjustment: 29 Effective length of query: 333 Effective length of database: 319 Effective search space: 106227 Effective search space used: 106227 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate Synpcc7942_2123 Synpcc7942_2123 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.24939.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-123 396.8 0.2 4.7e-123 396.7 0.2 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2123 Synpcc7942_2123 anthranilate pho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2123 Synpcc7942_2123 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.7 0.2 4.7e-123 4.7e-123 1 329 [. 15 344 .. 15 345 .. 0.99 Alignments for each domain: == domain 1 score: 396.7 bits; conditional E-value: 4.7e-123 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke.es 68 l++ll++++L + +a++lm++++sg + +a +A+l+al+ kg +++e+a++a++l+e+a+ ve++ + lcl|FitnessBrowser__SynE:Synpcc7942_2123 15 LQRLLNHESLGAVQARALMEQWLSGTLPEALSGALLAALQSKGVSAQELAAMAQVLQEQAVAVEASdRR 83 6899***********************************************************998789 PP TIGR01245 69 eelvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvars 137 e lvD++GTGGDg++t+NiSTa a+v aaaGvkvaKhGnrs+s+++GsaDvLealg+nl + ++++++ lcl|FitnessBrowser__SynE:Synpcc7942_2123 84 EPLVDTCGTGGDGAETFNISTAVAFVTAAAGVKVAKHGNRSASGRVGSADVLEALGLNLTAPSDRIHAA 152 99******************************************************************* PP TIGR01245 138 leevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknl 206 ++evgi+FlfAP +hpa+k+vap+Rk LgvrtvfNlLGPL+nP+r++ qv+Gvy++ l+ +++ +l +l lcl|FitnessBrowser__SynE:Synpcc7942_2123 153 VDEVGITFLFAPGWHPAMKAVAPLRKILGVRTVFNLLGPLVNPLRPTGQVIGVYNPGLLPTISGALAEL 221 ********************************************************************* PP TIGR01245 207 gvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevl 275 gv+ra+v+hg++glDE l + t+ a +++g+ +++ ++p+d+gl++a+ +lkggs eena++lk+vl lcl|FitnessBrowser__SynE:Synpcc7942_2123 222 GVRRAIVLHGREGLDEGGLADCTDLAIVREGQLSQQVVDPRDLGLTQAPTVALKGGSVEENADILKAVL 290 ********************************************************************* PP TIGR01245 276 egkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 +gk+++a++d+v+lNaa al v ++++ l +g++la+ ++ sg+a++kl++l+a lcl|FitnessBrowser__SynE:Synpcc7942_2123 291 QGKGTRAQQDAVLLNAALALEVGEQVDRLDQGISLARSVLASGAAWQKLTQLAA 344 **************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory