Align 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate GFF4775 PS417_24430 3-dehydroquinate dehydratase
Query= BRENDA::P15474 (157 letters) >FitnessBrowser__WCS417:GFF4775 Length = 149 Score = 169 bits (429), Expect = 1e-47 Identities = 86/147 (58%), Positives = 107/147 (72%), Gaps = 2/147 (1%) Query: 10 IMILNGPNLNLLGQRQPEIYGSDTLADVEALCVKAAAAHGGTVDFRQSNHEGELVDWIHE 69 +++LNGPNLNLLG R+P YG +TLADV ALC ++A G ++FRQ+NHEGEL+DWIH Sbjct: 5 VLVLNGPNLNLLGTREPATYGHETLADVAALCGRSAEQLGLKIEFRQTNHEGELLDWIHG 64 Query: 70 ARLNHCGIVINPAAYSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHHSYVSQRADG 129 AR GIVINPAA++HTSVAI DAL +PV+EVH+SN+H RE FRHHS+VS A Sbjct: 65 ARARCAGIVINPAAWTHTSVAIRDAL-VASEVPVIEVHLSNVHAREAFRHHSFVSPIAKA 123 Query: 130 VVAGCGVQGYVFGVERIAALAGAGSAR 156 V+AG G GY +E + L GSAR Sbjct: 124 VLAGFGSHGYHLALEHFSQLL-KGSAR 149 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 157 Length of database: 149 Length adjustment: 17 Effective length of query: 140 Effective length of database: 132 Effective search space: 18480 Effective search space used: 18480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
Align candidate GFF4775 PS417_24430 (3-dehydroquinate dehydratase)
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01088.hmm # target sequence database: /tmp/gapView.11943.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01088 [M=141] Accession: TIGR01088 Description: aroQ: 3-dehydroquinate dehydratase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-62 193.6 0.0 6.7e-62 193.4 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF4775 PS417_24430 3-dehydroquinate deh Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF4775 PS417_24430 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 193.4 0.0 6.7e-62 6.7e-62 2 139 .. 5 142 .. 4 144 .. 0.98 Alignments for each domain: == domain 1 score: 193.4 bits; conditional E-value: 6.7e-62 TIGR01088 2 ilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeqvdgivinpaal 76 +lvlnGPnlnlLG+rep+ yG+ tl ++ +l+ + a++l++++e++q+n+egel+d+ih a + givinpaa+ lcl|FitnessBrowser__WCS417:GFF4775 5 VLVLNGPNLNLLGTREPATYGHETLADVAALCGRSAEQLGLKIEFRQTNHEGELLDWIHGARARCAGIVINPAAW 79 89************************************************************************* PP TIGR01088 77 thtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGakgyklalealve 139 thtsva+rDal+a ++Pv+evhlsnvhare fr++s+++++ak v+ G+G +gy+lale + lcl|FitnessBrowser__WCS417:GFF4775 80 THTSVAIRDALVASEVPVIEVHLSNVHAREAFRHHSFVSPIAKAVLAGFGSHGYHLALEHFSQ 142 **********************************************************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (141 nodes) Target sequences: 1 (149 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 4.58 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory