Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate GFF24 PS417_00125 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >FitnessBrowser__WCS417:GFF24 Length = 272 Score = 439 bits (1128), Expect = e-128 Identities = 213/272 (78%), Positives = 245/272 (90%) Query: 1 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVT 60 MD+YVVFGNPIGHSKSPLIHR+FAEQTG+ L+Y+TLLAPL++FS CAR FF+QG G NVT Sbjct: 1 MDRYVVFGNPIGHSKSPLIHRMFAEQTGEQLDYSTLLAPLEDFSGCAREFFQQGRGANVT 60 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VPFKE+A+RL +SLT RA+RAGAVNTLSKLADG+L GDNTDGAGLVRDLTVNAG+ L GK Sbjct: 61 VPFKEDAYRLANSLTERAQRAGAVNTLSKLADGSLLGDNTDGAGLVRDLTVNAGLNLQGK 120 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEP 180 RIL+LGAGGAVRG LEP+LA +P SL+IANRTVEKAE LA FD+LGPV ASGF WL+EP Sbjct: 121 RILLLGAGGAVRGALEPLLAEQPASLIIANRTVEKAEMLAELFDDLGPVSASGFDWLREP 180 Query: 181 VDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLG 240 VDVIINATSASL+G++PPIA SL+E G+T CYDMMY KEPT FC+WAT+ GA+ +DGLG Sbjct: 181 VDVIINATSASLSGDVPPIASSLIEPGKTFCYDMMYAKEPTAFCRWATEHGASVAMDGLG 240 Query: 241 MLAEQAAEAFFIWRGVRPDTAPVLAELRRQLA 272 ML EQAAEAF++WRGVRPD+APVLAELRRQLA Sbjct: 241 MLVEQAAEAFYLWRGVRPDSAPVLAELRRQLA 272 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 272 Length adjustment: 25 Effective length of query: 249 Effective length of database: 247 Effective search space: 61503 Effective search space used: 61503 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF24 PS417_00125 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.15558.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-80 255.3 0.0 3.2e-80 255.1 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF24 PS417_00125 shikimate dehydrogen Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF24 PS417_00125 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 255.1 0.0 3.2e-80 3.2e-80 3 269 .. 4 271 .. 2 272 .] 0.93 Alignments for each domain: == domain 1 score: 255.1 bits; conditional E-value: 3.2e-80 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeieesak 79 + v+Gnpi hSksplih +++q+g +l Y + +++e+++ +++++g +G+nvTvPfKe +++l+ ++e+a+ lcl|FitnessBrowser__WCS417:GFF24 4 YVVFGNPIGHSKSPLIHRMFAEQTGEQLDYSTLLAPLEDFSGCAREFFQQG-RGANVTVPFKEDAYRLANSLTERAQ 79 78************************************************9.8************************ PP TIGR00507 80 ligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRtveka 153 +gavNTl l dg l+g+nTDg Glv +L ++kr+l++GAGGa ++++ +Ll + + ++iiaNRtveka lcl|FitnessBrowser__WCS417:GFF24 80 RAGAVNTLSkLADGSLLGDNTDGAGLVRDLTVnAGLNLQGKRILLLGAGGAVRGALEPLLAEqPASLIIANRTVEKA 156 ********99********************9954433359*****************988664899*********** PP TIGR00507 154 eelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellkegk.lvvDlvynpletpllkeakkk 229 e lae + lg + a + + + vd+iinatsa+lsg++ +++ ++l++ gk +++D++y++ t++ ++a ++ lcl|FitnessBrowser__WCS417:GFF24 157 EMLAELFDDLGPVSASGFDWL-REPVDVIINATSASLSGDV--PPIASSLIEPGKtFCYDMMYAKEPTAFCRWATEH 230 ***********9988775554.567****************..********99862689****************** PP TIGR00507 230 g.tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 g + +dGlgMlv+Qaa +F lw+gv pd v l+++l lcl|FitnessBrowser__WCS417:GFF24 231 GaSVAMDGLGMLVEQAAEAFYLWRGVRPDSAPVLAELRRQL 271 *55668************************99999988877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (272 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 5.99 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory