Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); quinate/shikimate dehydrogenase [NAD(P)+] (EC 1.1.1.282) (characterized)
to candidate Ac3H11_1226 Quinate/shikimate 5-dehydrogenase I delta (EC 1.1.1.25)
Query= BRENDA::Q88K85 (282 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1226 Length = 303 Score = 276 bits (706), Expect = 4e-79 Identities = 146/277 (52%), Positives = 189/277 (68%), Gaps = 2/277 (0%) Query: 2 SQQAILAGLIGRGIQLSRTPALHEHEGDAQALRYLYRLIDADQLQLDDSALPGLLEAAQH 61 S + +L GLIG GIQ S +PALHE E +R Y+LID D+ LP LL AA+ Sbjct: 21 SPRKVLIGLIGAGIQKSLSPALHEEEARHHGMRLHYQLIDLDRSASSVEHLPTLLSAARI 80 Query: 62 TGFTGLNITYPFKQAILPLLDELSDEARGIGAVNTVVLKDGKRVGHNTDCLGFAEGLRRG 121 G+ G N+TYP KQA++P LD LS+EAR +GAVNTVV++DG+ VGHNTD G+A G R Sbjct: 81 MGYAGCNVTYPCKQAVIPHLDSLSEEARAMGAVNTVVIRDGQLVGHNTDGSGWAWGFTRA 140 Query: 122 LPDVARRQVVQMGAGGAGSAVAHALLGEGVERLVLFEVDATRAQALVDNLNTHFGAERAV 181 LP +VV +GAGGAG+A+AHA+L G + L + + RA L ++N +GA RA Sbjct: 141 LPGADLGRVVLLGAGGAGAAIAHAVLRLGAQHLSIVDAQPERAAQLAADVNALYGA-RAE 199 Query: 182 LGTDLATALAEADGLVNTTPVGMAKLPGTPLPVELLHPRLWVAEIIYFPLETELLRAARA 241 G ++ +A+A A GL++ TP GM KLPG PL V LL P +WV+E++YFPL+T L++AARA Sbjct: 200 AG-EIRSAMANATGLIHATPTGMDKLPGLPLDVGLLRPAMWVSEVVYFPLDTALVQAARA 258 Query: 242 LGCRTLDGSNMAVFQAVKAFELFSGRQADAARMQAHF 278 LGC+ DG MAV QAV AFELF+G DA RM AHF Sbjct: 259 LGCKVSDGGGMAVGQAVGAFELFTGEAPDATRMDAHF 295 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 303 Length adjustment: 26 Effective length of query: 256 Effective length of database: 277 Effective search space: 70912 Effective search space used: 70912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory