Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (characterized)
to candidate Ac3H11_4044 Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)
Query= SwissProt::Q9KVT3 (278 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4044 Length = 284 Score = 233 bits (595), Expect = 3e-66 Identities = 132/272 (48%), Positives = 166/272 (61%), Gaps = 7/272 (2%) Query: 6 DQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVT 65 D Y V GNP+ HS+SP IH FA T + + Y + VP+DGF + + F A+GGRGCNVT Sbjct: 9 DLYCVMGNPVAHSRSPAIHARFAELTGEPIAYERRLVPMDGFAQGVRDFVAEGGRGCNVT 68 Query: 66 VPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQQ-VLLKGA 124 VPFK +A A +ER +LAGA NTL DG I DNTDG GLV D+ V L G Sbjct: 69 VPFKTDAPGLATACSERVQLAGAANTLTFRADGSIYADNTDGLGLVADITHNAGVPLAGR 128 Query: 125 TILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGEVKAQAFEQLKQS 184 +LL+GAGGAA GVL PLL ITV NRT AKA+ L E ++ E L+ S Sbjct: 129 DVLLVGAGGAAAGVLGPLLLAGARHITVANRTLAKAQALVESHRPLALLQKAELEALEPS 188 Query: 185 -----YDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQAI 239 +DVIIN+T++SL G + + ++ YDMMYG F WAR HG A Sbjct: 189 AVTANFDVIINATASSLAGAGVPVPASVLRPGALAYDMMYGPAAQEFLDWARSHG-AVPR 247 Query: 240 DGLGMLVGQAAESFMLWRGLRPGTKQILRELR 271 DGLGMLV QAAE+F+LWRG+RP + Q+L E++ Sbjct: 248 DGLGMLVEQAAEAFLLWRGVRPPSAQVLHEMQ 279 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 284 Length adjustment: 26 Effective length of query: 252 Effective length of database: 258 Effective search space: 65016 Effective search space used: 65016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate Ac3H11_4044 (Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25))
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.15510.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-73 230.8 0.0 9.8e-73 230.6 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 Shikimate 5-dehydrogenase I alph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 230.6 0.0 9.8e-73 9.8e-73 2 265 .. 10 278 .. 9 282 .. 0.96 Alignments for each domain: == domain 1 score: 230.6 bits; conditional E-value: 9.8e-73 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPf 63 l+ v+Gnp++hS sp+ih ++++ +g + Y + v+++ + + + + a+g +G+nvTvPf lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 10 LYCVMGNPVAHSRSPAIHARFAELTGEPIAYERRLVPMDGFAQGVRDFVAEGGRGCNVTVPF 71 799*********************************************************** PP TIGR00507 64 KeevlellDeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvlii 123 K+ + l+ +e+++l+ga NTl+ + dg ++++nTDg+Glv+++ + + +++ vl++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 72 KTDAPGLATACSERVQLAGAANTLTfRADGSIYADNTDGLGLVADITHnAGVPLAGRDVLLV 133 *************************999*******************98888888******* PP TIGR00507 124 GAGGaakavaleLlka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkk....vd 180 GAGGaa +v+ +Ll a ++++aNRt++ka++l+e + l ++ +le +e++ +d lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 134 GAGGAAAGVLGPLLLAgARHITVANRTLAKAQALVESHRPLALLQKAELEALEPSAvtanFD 195 ************99996789********************99999999999998765667** PP TIGR00507 181 liinatsaglsgeideaevkaellkegklvvDlvynpletpllkeakkkgtkvidGlgMlva 242 +iinat+++l g ++v+a++l+ g+l++D++y p +l +a+++g+ dGlgMlv+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 196 VIINATASSLAGAG--VPVPASVLRPGALAYDMMYGPAAQEFLDWARSHGAVPRDGLGMLVE 255 ************99..********************************************** PP TIGR00507 243 QaalsFelwtgvepdvekvfeal 265 Qaa +F lw+gv p+ +v + + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4044 256 QAAEAFLLWRGVRPPSAQVLHEM 278 *************9988887766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (284 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory