Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate Ac3H11_4034 2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha (EC 2.5.1.54)
Query= BRENDA::C3TIE2 (350 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4034 Length = 373 Score = 429 bits (1104), Expect = e-125 Identities = 215/351 (61%), Positives = 263/351 (74%), Gaps = 5/351 (1%) Query: 4 QNDDLRIKEIKELLPPVALLEKFPATENAANT-VAHARKAIHKILKGNDDRLLVVIGPCS 62 Q DD RIK+I L PP L+ FP T + RK IH I+ G DDRLLV+IGPCS Sbjct: 21 QTDDERIKDITVLPPPEHLIRFFPIGGTPVETLITQTRKNIHNIMAGKDDRLLVIIGPCS 80 Query: 63 IHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDG 122 IHDP AA +YA RL+A+R + D LEIVMRVYFEKPRTTVGWKGLINDP++D S++I++G Sbjct: 81 IHDPAAAVDYARRLMAVRTQYADTLEIVMRVYFEKPRTTVGWKGLINDPYLDESYRIDEG 140 Query: 123 LRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCP 182 LRIAR+LL++IN G+PA EFLD+I+PQY+ DL+SWGAIGARTTESQVHRELASG+S P Sbjct: 141 LRIARQLLIEINRLGMPAGSEFLDVISPQYIGDLISWGAIGARTTESQVHRELASGISAP 200 Query: 183 VGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPNYS 242 +GFKNGTDG I++A DAI +A H FLSV K G AIVNT GN DCH+ILRGGK PNY Sbjct: 201 IGFKNGTDGNIRIATDAIQSASRGHHFLSVHKNGQVAIVNTKGNKDCHVILRGGKTPNYD 260 Query: 243 AKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVE 302 A VA + L A LPA +M+D SHANSSKQ +KQ++V DV Q+AGG +++ G+M+E Sbjct: 261 AVSVAAACKDLEAAKLPATLMVDCSHANSSKQHEKQLEVARDVAAQLAGGSRSVFGLMIE 320 Query: 303 SHLVEGNQSLESGE----PLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 SHL G Q G+ L YGKSITDAC+GW+D+ L +L++AVKARR Sbjct: 321 SHLTAGAQKFTPGKDDASKLEYGKSITDACLGWDDSLQALAELSDAVKARR 371 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 373 Length adjustment: 29 Effective length of query: 321 Effective length of database: 344 Effective search space: 110424 Effective search space used: 110424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Ac3H11_4034 (2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha (EC 2.5.1.54))
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.30673.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-164 532.5 0.0 2e-164 532.3 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 2-keto-3-deoxy-D-arabino-heptulo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 532.3 0.0 2e-164 2e-164 1 342 [] 23 371 .. 23 371 .. 0.97 Alignments for each domain: == domain 1 score: 532.3 bits; conditional E-value: 2e-164 TIGR00034 1 ddlrivkidelltPeelkakfpltek.aaekvaksrkeiadilaGkddrllvviGPcsihdp 61 dd ri++i l +Pe+l++ fp+ + +++ ++++rk+i++i+aGkddrllv+iGPcsihdp lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 23 DDERIKDITVLPPPEHLIRFFPIGGTpVETLITQTRKNIHNIMAGKDDRLLVIIGPCSIHDP 84 7899*******************8762566799***************************** PP TIGR00034 62 eaaleyakrlkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriark 123 aa++ya+rl +++ ++ d leivmrvyfekPrttvGWkGlindP+l+es+++++Glriar+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 85 AAAVDYARRLMAVRTQYADTLEIVMRVYFEKPRTTVGWKGLINDPYLDESYRIDEGLRIARQ 146 ************************************************************** PP TIGR00034 124 llldlvelglplatelldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtd 185 ll++++ lg+p+++e+ld+ispqy++dl+swgaiGarttesqvhrelasg+s p+gfkngtd lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 147 LLIEINRLGMPAGSEFLDVISPQYIGDLISWGAIGARTTESQVHRELASGISAPIGFKNGTD 208 ************************************************************** PP TIGR00034 186 GslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGkkpnydaedvaevkee 247 G++++a dai++a++ h+flsv+k+Gqvaiv+tkGn+d+h+ilrGGk+pnyda +va+++++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 209 GNIRIATDAIQSASRGHHFLSVHKNGQVAIVNTKGNKDCHVILRGGKTPNYDAVSVAAACKD 270 ************************************************************** PP TIGR00034 248 lekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl.. 307 le+a+l ++lm+d+sh+ns+k++++qleva++v++q+a G+++++G+mies+l+ G+q+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 271 LEAAKLPATLMVDCSHANSSKQHEKQLEVARDVAAQLAGGSRSVFGLMIESHLTAGAQKFtp 332 **********************************************************9744 PP TIGR00034 308 .k...eelkyGksvtdacigwedteallrklaeavkerr 342 k ++l+yGks+tdac+gw+d+ + l++l++avk+rr lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4034 333 gKddaSKLEYGKSITDACLGWDDSLQALAELSDAVKARR 371 31333679****************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (373 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.05 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory