Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate AZOBR_RS10920 AZOBR_RS10920 carbamoyl phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__azobra:AZOBR_RS10920 Length = 391 Score = 406 bits (1043), Expect = e-118 Identities = 206/377 (54%), Positives = 260/377 (68%), Gaps = 10/377 (2%) Query: 4 SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 63 + +LVL DGT F GR IGA G +VGEV FNTSMTGYQEILTDPSY+ QI+T T+PHIGN Sbjct: 15 TGVLVLADGTVFKGRGIGAVGDSVGEVCFNTSMTGYQEILTDPSYAGQIITFTFPHIGNT 74 Query: 64 GTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLR 123 G N D E+ A+GL++R SN+R T L +LK + +V +A +DTR+LTR +R Sbjct: 75 GANPEDIETVTPAARGLILRADVTDPSNWRATRHLDDWLKSYGLVGLAGVDTRRLTRRIR 134 Query: 124 EKGAQNGCIIAGDNPDAALALE----KARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTG 179 + GA NG + PD L+ KA+ +PGL GMDLAK+V+ + Y W +G+WTL Sbjct: 135 DLGAPNG--VVAHAPDGKFDLDALVAKAKGWPGLEGMDLAKDVSCRQTYGWDEGAWTLGA 192 Query: 180 GLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLS 239 G ++ FHVVA DFGAKRNILR L GC++T+VP + EDV++ PDG+FLS Sbjct: 193 GYAT---QESPRFHVVAIDFGAKRNILRCLAAAGCKVTVVPGTATVEDVMRHKPDGVFLS 249 Query: 240 NGPGDPAPC-DYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVK 298 NGPGDPA +YA+ I+ L+T +P+FGICLGHQ+L+LA GAKT KM GH G NHPVK Sbjct: 250 NGPGDPAATGEYAVPTIKGLLDTGLPMFGICLGHQMLSLALGAKTKKMPLGHRGANHPVK 309 Query: 299 DVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASP 358 D+ V IT+QNHGF V E TLPA+ VTH SLFDGT +GI +KP FS Q HPEASP Sbjct: 310 DLASGRVEITSQNHGFVVMEETLPADAEVTHVSLFDGTNEGIRLKNKPVFSVQYHPEASP 369 Query: 359 GPHDAAPLFDHFIELIE 375 GP D+ LFD F+ L++ Sbjct: 370 GPQDSHYLFDRFVALMD 386 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 391 Length adjustment: 30 Effective length of query: 352 Effective length of database: 361 Effective search space: 127072 Effective search space used: 127072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS10920 AZOBR_RS10920 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.10081.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-143 463.6 0.0 2.4e-143 463.4 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS10920 AZOBR_RS10920 carbamoyl phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS10920 AZOBR_RS10920 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 463.4 0.0 2.4e-143 2.4e-143 2 360 .. 17 386 .. 16 387 .. 0.95 Alignments for each domain: == domain 1 score: 463.4 bits; conditional E-value: 2.4e-143 TIGR01368 2 tlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskk 70 +lvl+dGtvf+g+++ga ++ vGev+FnTsmtGYqEiltDpsY+gqi+++t p+ign+g n+ed+e + lcl|FitnessBrowser__azobra:AZOBR_RS10920 17 VLVLADGTVFKGRGIGAVGDSVGEVCFNTSMTGYQEILTDPSYAGQIITFTFPHIGNTGANPEDIETVT 85 69******************************************************************* PP TIGR01368 71 ikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse...ke 136 + ++gl+++ +++sn+ra++ L+++lk++g+v+++gvDTR l++++R+ g+ ++v++++ + lcl|FitnessBrowser__azobra:AZOBR_RS10920 86 PAARGLILRADVTDPSNWRATRHLDDWLKSYGLVGLAGVDTRRLTRRIRDLGAPNGVVAHAPDGkfdLD 154 ***********************************************************9875544478 PP TIGR01368 137 elvekakespkvkevnlvkevstkeayeleq.....k...akkegkklrvvvidlGvKenilreLvkrg 197 lv+kak p +++++l+k+vs++++y + + a++e+ + +vv+id+G K+nilr+L++ g lcl|FitnessBrowser__azobra:AZOBR_RS10920 155 ALVAKAKGWPGLEGMDLAKDVSCRQTYGWDEgawtlGagyATQESPRFHVVAIDFGAKRNILRCLAAAG 223 9999999***********************97665515657788888********************** PP TIGR01368 198 vevtvvpadtsaeeikklnpdgillsnGPGdPaav.eeaietvkklleakiPifGIclGhqllalalga 265 ++vtvvp ++++e++++ +pdg++lsnGPGdPaa e+a+ t+k ll++ +P+fGIclGhq+l+lalga lcl|FitnessBrowser__azobra:AZOBR_RS10920 224 CKVTVVPGTATVEDVMRHKPDGVFLSNGPGDPAATgEYAVPTIKGLLDTGLPMFGICLGHQMLSLALGA 292 ********************************77637889***************************** PP TIGR01368 266 ktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfs 334 kt k+ GhrGaNhpvkdl++grveitsqNHg++v ee+l+++ +evthv+l+Dgt+eg++ k++pvfs lcl|FitnessBrowser__azobra:AZOBR_RS10920 293 KTKKMPLGHRGANHPVKDLASGRVEITSQNHGFVVMEETLPAD-AEVTHVSLFDGTNEGIRLKNKPVFS 360 ***************************************8855.************************* PP TIGR01368 335 vQyHPeaspGphdteylFdefvelik 360 vQyHPeaspGp+d++ylFd+fv l++ lcl|FitnessBrowser__azobra:AZOBR_RS10920 361 VQYHPEASPGPQDSHYLFDRFVALMD 386 **********************9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.95 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory