Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate AZOBR_RS01765 AZOBR_RS01765 shikimate 5-dehydrogenase
Query= reanno::Caulo:CCNA_00003 (285 letters) >FitnessBrowser__azobra:AZOBR_RS01765 Length = 279 Score = 203 bits (516), Expect = 4e-57 Identities = 113/264 (42%), Positives = 147/264 (55%) Query: 5 ITGAAIVGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFAPAADRFETFVDGLRGGAVR 64 I+G A + GV G PI HS SP +H W+ G+D AYVP A DR E + L R Sbjct: 3 ISGKATLAGVMGWPIGHSRSPRLHGYWLEQYGIDGAYVPLAVPPDRIEQAIRALPALGFR 62 Query: 65 GLNVTIPFKERALAVADTASDLARMAGAANLLVFNEDGSVHADNTDGPGLLGAIAIQAPG 124 G NVT+P KE A D A+ GA N +V E+GS+ NTDG G + + APG Sbjct: 63 GCNVTVPHKEAACRTVDRLDATAKRMGAVNTIVVGENGSLEGRNTDGFGFIENLRSGAPG 122 Query: 125 FDVTAAPVVILGAGGAARGAVAALLLAGAPRIAVVNRTVARAQDLADTFGEKVVAKGEDA 184 + P +++GAGGAAR VA+LL GAPR+ +VNRT ARA +LA G + + Sbjct: 123 WKAADGPALVIGAGGAARAVVASLLDEGAPRVWLVNRTRARADELAADIGGAIETADWVS 182 Query: 185 LPALLPEAGLIINATSLGLGGGAGPSADLTLTPKTAVVMDMVYKPLRTEFLRRAEAAGRR 244 LL A L++N T+ G+ G +L P +AVV D+VY PL T L A+A G R Sbjct: 183 RETLLEGAALVVNTTTQGMAGQPPLELNLRALPGSAVVTDIVYTPLMTPLLTAAQARGNR 242 Query: 245 TVDGLEMLLRQAIPTFETIYGQAP 268 VDG+ MLL QA P F +G+ P Sbjct: 243 VVDGVGMLLHQARPGFAAWFGREP 266 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 279 Length adjustment: 26 Effective length of query: 259 Effective length of database: 253 Effective search space: 65527 Effective search space used: 65527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate AZOBR_RS01765 AZOBR_RS01765 (shikimate 5-dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.5301.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-71 225.4 0.0 4.4e-71 225.1 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS01765 AZOBR_RS01765 shikimate 5-dehydr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS01765 AZOBR_RS01765 shikimate 5-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.1 0.0 4.4e-71 4.4e-71 2 260 .. 9 270 .. 8 277 .. 0.95 Alignments for each domain: == domain 1 score: 225.1 bits; conditional E-value: 4.4e-71 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 l gv+G pi hS sp +h l+q g+++ Y+ + v+++++e+a+ ++ alg++G+nvTvP+Ke++ + lcl|FitnessBrowser__azobra:AZOBR_RS01765 9 LAGVMGWPIGHSRSPRLHGYWLEQYGIDGAYVPLAVPPDRIEQAIRALPALGFRGCNVTVPHKEAACRT 77 579****************************************************************** PP TIGR00507 71 lDeieesakligavNTlk.ledgklvgynTDgiGlvssLek..lsklksekrvliiGAGGaakavaleL 136 +D+++ +ak +gavNT++ e+g l+g nTDg G++ +L+ + ++ +l+iGAGGaa+av+ +L lcl|FitnessBrowser__azobra:AZOBR_RS01765 78 VDRLDATAKRMGAVNTIVvGENGSLEGRNTDGFGFIENLRSgaPGWKAADGPALVIGAGGAARAVVASL 146 *****************9789******************9975677788999***************** PP TIGR00507 137 lka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaell 204 l++ +v ++NRt ++a ela + e+ + e l+ l++n+t g+ g+ e++ l lcl|FitnessBrowser__azobra:AZOBR_RS01765 147 LDEgAPRVWLVNRTRARADELAADIGGAIETADWVSRETLLEGAALVVNTTTQGMAGQP-PLELNLRAL 214 **96679********************9999999999999****************998.78999999* PP TIGR00507 205 kegklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvek 260 +++v D+vy pl tpll a+ +g +v+dG+gMl +Qa F w+g ep+v + lcl|FitnessBrowser__azobra:AZOBR_RS01765 215 PGSAVVTDIVYTPLMTPLLTAAQARGNRVVDGVGMLLHQARPGFAAWFGREPEVTE 270 ****************************************************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (279 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.49 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory