Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate AZOBR_RS25375 AZOBR_RS25375 serine acetyltransferase
Query= BRENDA::Q0ZB96 (273 letters) >FitnessBrowser__azobra:AZOBR_RS25375 Length = 260 Score = 303 bits (776), Expect = 2e-87 Identities = 146/250 (58%), Positives = 186/250 (74%), Gaps = 1/250 (0%) Query: 9 VWNNIKAEARALADCEPMLASFYHATLLKHENLGSALSYMLANKLASPIMPAIAIREVVE 68 +W ++ EA A+AD +P+L F H +L H+ SAL LA KL +PA + ++ E Sbjct: 1 LWARLRTEAEAVADGDPLLRGFIHIVVLSHDGFASALGGHLARKLGDWYIPAERLADITE 60 Query: 69 EAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWTQGRRAL 128 +A+A DP ++A+A D+ A+ TRDPA D TP LY KGFHALQ +R+ HWLW QGRR L Sbjct: 61 QAHAGDPGIVAAAVADLTAIVTRDPAADGLLTPFLYFKGFHALQWHRVAHWLWAQGRRDL 120 Query: 129 AIFLQNQVSVSFQVDIHPAAKIGRGIMLDHATGIVVGETAVIEDDVSILQSVTLGGTGKT 188 FLQ++VS F VDIHPA IGRG+++DH TG+V+GETAV+ DDVSILQ VTLGGTGK Sbjct: 121 PHFLQSRVSEVFAVDIHPAVSIGRGVLIDHGTGVVIGETAVVGDDVSILQGVTLGGTGKE 180 Query: 189 SGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKPE 248 GDRHPK+R+GV++ AGAK+LGNIEVGR AK+GAGSVVL+PVPP T AGVPAR+VG Sbjct: 181 HGDRHPKVRDGVLLAAGAKVLGNIEVGRHAKVGAGSVVLKPVPPGATVAGVPARVVGWLT 240 Query: 249 SDK-PAMDMD 257 S + PA++MD Sbjct: 241 SGQAPAVEMD 250 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 260 Length adjustment: 25 Effective length of query: 248 Effective length of database: 235 Effective search space: 58280 Effective search space used: 58280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate AZOBR_RS25375 AZOBR_RS25375 (serine acetyltransferase)
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01172.hmm # target sequence database: /tmp/gapView.28170.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01172 [M=162] Accession: TIGR01172 Description: cysE: serine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-74 235.8 2.5 1.8e-74 235.3 2.5 1.2 1 lcl|FitnessBrowser__azobra:AZOBR_RS25375 AZOBR_RS25375 serine acetyltrans Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS25375 AZOBR_RS25375 serine acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 235.3 2.5 1.8e-74 1.8e-74 3 162 .] 75 234 .. 73 234 .. 0.99 Alignments for each domain: == domain 1 score: 235.3 bits; conditional E-value: 1.8e-74 TIGR01172 3 edlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdihPaakig 71 +dl+a+++rDPaa+ l+++l++kg+hal+++r+ah+l+ ++++ l ++l+++v+ ++ vdihPa +ig lcl|FitnessBrowser__azobra:AZOBR_RS25375 75 ADLTAIVTRDPAADGLLTPFLYFKGFHALQWHRVAHWLWAQGRRDLPHFLQSRVSEVFAVDIHPAVSIG 143 799****************************************************************** PP TIGR01172 72 rgvliDhatGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagakvLGnievgenaki 140 rgvliDh+tGvviGetav+gddvsi+qgvtLGgtgke+g+RhP+v++gv+++agakvLGnievg +ak+ lcl|FitnessBrowser__azobra:AZOBR_RS25375 144 RGVLIDHGTGVVIGETAVVGDDVSILQGVTLGGTGKEHGDRHPKVRDGVLLAAGAKVLGNIEVGRHAKV 212 ********************************************************************* PP TIGR01172 141 GansvvlkdvpaeatvvGvpar 162 Ga+svvlk+vp++atv+Gvpar lcl|FitnessBrowser__azobra:AZOBR_RS25375 213 GAGSVVLKPVPPGATVAGVPAR 234 ********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (162 nodes) Target sequences: 1 (260 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.75 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory