Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate AZOBR_RS22825 AZOBR_RS22825 amidotransferase
Query= curated2:A4TE06 (494 letters) >FitnessBrowser__azobra:AZOBR_RS22825 Length = 463 Score = 214 bits (545), Expect = 5e-60 Identities = 171/494 (34%), Positives = 234/494 (47%), Gaps = 37/494 (7%) Query: 7 LDAATLADKISSKEVSSAEVTQAFLDQIAATDGDYHAFLHVGAEQALAAAQTVDRAVAAG 66 + A +A++++++ VS+ + L++IAA + +A +H+ E A A+ D A G Sbjct: 1 MSARRIAEQVAARAVSAVALYDDLLERIAAENPRLNAIVHLDPEAGRAEARAADARAARG 60 Query: 67 EHLPSPLAGVPLALKDVFTTTDMPTTCGSKVLEGWTSPYDATVTAKLRSAGIPILGKTNM 126 E LP L GVP +KD P GS++ + + P DA A+LR+AG G TN Sbjct: 61 EALP--LLGVPFTVKDNIWVRGQPVRQGSRLFQDFVGPEDAVAVARLRAAGAVFAGITNC 118 Query: 127 DEFAMGSSTENSAYGPTRNPWDTERVPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAA 186 EFA T N +GPTRNPWD PGGS GG+A+A+AA APLA+ TD GGS R+PAA Sbjct: 119 SEFACKGVTTNLLHGPTRNPWDVALTPGGSSGGAASAVAAGLAPLALCTDGGGSTRRPAA 178 Query: 187 LTATVGVKPTYGTVSR-YGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPLDSTSVEA 245 VG+KP+ G V G G AR+V D AL+ V+AG DP D S Sbjct: 179 HVGVVGMKPSAGVVPHPVGFAEPVFGNSVIGQMARSVGDVALMLDVLAGPDPRDPQS--- 235 Query: 246 PVPDVVAAARTGAGGDLTGVRIGVVKQLRSGEGYQAGVLASFNAAVDQLTALGAEVTEVD 305 +P + AR A D G+RI ++L V A AV +L GA V E D Sbjct: 236 -LPLSGSFARAIANPDPAGLRIAYSRRLGLDAPVDPEVAACVERAVHRLADAGAIVEEAD 294 Query: 306 CPHFDYSLPAYYLILPSEVSSNLAKFDGMRYGLRAGDDGTHSAEEVMALTRAAGFGPEVK 365 D + + + L + LA G RY RA D F P++ Sbjct: 295 PVWPDGAGESGLMPLQ---FAGLAALYGERY--RATPD---------------LFDPDIG 334 Query: 366 RRIMIGAYALSAGYYDAYYNQAQKVRTLIARDLDAAYQKVDVLVSPATPTTAF---RLGE 422 ++I G A A + + + R L A + + D+LV P TP TA+ RLG Sbjct: 335 QQIEAGLRTSGAEVARALHLREEAYRALA-----ALFTRFDLLVCPTTPVTAWPFDRLGP 389 Query: 423 KVDD--PLSMYLFDLCTLPLNLAGHCGMSVPSGLSADDNLPVGLQIMAPALADDRLYRVG 480 D P++ + T N SVP GL+ LPVGLQI P L+D + R+ Sbjct: 390 ATIDGRPVTPRGHAVFTPLFNHCYAPACSVPCGLTESGGLPVGLQIAGPRLSDAAVLRLA 449 Query: 481 AAYEAARGPLPTAL 494 A EA G P L Sbjct: 450 AVVEATCGYTPPML 463 Lambda K H 0.316 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 494 Length of database: 463 Length adjustment: 34 Effective length of query: 460 Effective length of database: 429 Effective search space: 197340 Effective search space used: 197340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory