Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate AZOBR_RS14130 AZOBR_RS14130 3-isopropylmalate dehydrogenase
Query= BRENDA::P24404 (370 letters) >FitnessBrowser__azobra:AZOBR_RS14130 Length = 371 Score = 472 bits (1214), Expect = e-138 Identities = 235/368 (63%), Positives = 291/368 (79%), Gaps = 2/368 (0%) Query: 4 RSLFLLPGDGIGPEAMTEVRKLIEYMNSAHNAGFTVSEGLVGGSAYDAHGVAISDADMEK 63 + L LPGDGIGPE M +VR++I++++ N F V+EGLVGG+A DA+GV + D + Sbjct: 5 KKLLFLPGDGIGPEVMRQVRRVIDWLDRKRNVTFDVTEGLVGGAAIDAYGVPLKDETLAD 64 Query: 64 ALAADAILFGAVGGPKWDG-VPYEHRPEAGLLRLRKDLELFANLRPAICYPALAAASSLK 122 ALAADA++ GAVGGPKWD Y RPEAGLL LRK+L LFANLRPA+ + AL AS+LK Sbjct: 65 ALAADAVMLGAVGGPKWDNPTDYTKRPEAGLLSLRKELNLFANLRPAVVFDALVDASTLK 124 Query: 123 PELVEGLDILIVRELTGGVYFGEPKQIIDLGNGQKRGIDTQIYDTFEIERIASVAFELAR 182 ++++GLDILIVRELTGGVYFGEP+ I D+GNG++RG++TQ+Y T EI R+A VAFELAR Sbjct: 125 ADVIKGLDILIVRELTGGVYFGEPRGITDIGNGERRGVNTQVYTTSEIRRVARVAFELAR 184 Query: 183 SRDNRVCSMEKRNVMKSGVLWNQVVTETHAAKYKDVQLEHMLADAGGMQLVRKPKQFDVI 242 R N++ SMEK NVM+SG+LW Q VT+ H ++ DV LEHM AD G MQL++ PKQFDVI Sbjct: 185 KRGNKLHSMEKANVMESGLLWRQEVTKLHQEEFSDVTLEHMYADNGAMQLLKNPKQFDVI 244 Query: 243 VTDNLFGDMLSDVAAMLTGSLGMLPSASLGAPDAKTGKRKAMYEPVHGSAPDIAGKSIAN 302 VTDNLFGD+LSD AAM+TGSLGMLPSASLGAPDA G+RKA+YEPVHGSAPDIAG+ +AN Sbjct: 245 VTDNLFGDILSDEAAMMTGSLGMLPSASLGAPDA-NGQRKALYEPVHGSAPDIAGRDLAN 303 Query: 303 PIAMIASFAMCLRYSFNMVDEATKLEAAIANVLDKGIRTADIMADGCRQVGTSDMGDAVL 362 P A + SFAMCLRYSFNM +EA LE A+ NVL G+RTADIMA G + T+ MGD++L Sbjct: 304 PCATLLSFAMCLRYSFNMDEEAKMLEKAVQNVLSGGMRTADIMAPGMARCSTTVMGDSIL 363 Query: 363 AEFKALSA 370 E L++ Sbjct: 364 RELDKLAS 371 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 371 Length adjustment: 30 Effective length of query: 340 Effective length of database: 341 Effective search space: 115940 Effective search space used: 115940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AZOBR_RS14130 AZOBR_RS14130 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.16045.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-148 480.0 0.0 2.4e-148 479.8 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS14130 AZOBR_RS14130 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS14130 AZOBR_RS14130 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 479.8 0.0 2.4e-148 2.4e-148 2 348 .. 7 361 .. 6 362 .. 0.98 Alignments for each domain: == domain 1 score: 479.8 bits; conditional E-value: 2.4e-148 TIGR00169 2 iavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlga 70 + LpGDgiGpev+ + +v++ ++ + ++ ++ e l+GGaaida+g Pl +etl+ + +adav+lga lcl|FitnessBrowser__azobra:AZOBR_RS14130 7 LLFLPGDGIGPEVMRQVRRVIDWLDRKRNVTFDVTEGLVGGAAIDAYGVPLKDETLADALAADAVMLGA 75 5689***************************************************************** PP TIGR00169 71 vGGpkWdnlpr.dvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiY 138 vGGpkWdn +rPe gLL+lrkel+lfanLrPa +f++L+++s+lk++++kg+D+++vreLtgG+Y lcl|FitnessBrowser__azobra:AZOBR_RS14130 76 VGGPKWDNPTDyTKRPEAGLLSLRKELNLFANLRPAVVFDALVDASTLKADVIKGLDILIVRELTGGVY 144 ********864368******************************************************* PP TIGR00169 139 fGepkereeaee.ekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeia 206 fGep+++++ ++ e+++++t++Yt++ei+r+arvafelarkr +k+ s++kanv+es+ lWr+ v++++ lcl|FitnessBrowser__azobra:AZOBR_RS14130 145 FGEPRGITDIGNgERRGVNTQVYTTSEIRRVARVAFELARKRGNKLHSMEKANVMESGLLWRQEVTKLH 213 *********9999*******************************************************9 PP TIGR00169 207 k.eyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslss.....kg 269 + e+ dv+leh+y Dn amqL+k+P+q+dv+vt+nlfGDilsDea+++tGslG+LPsasl+ ++ lcl|FitnessBrowser__azobra:AZOBR_RS14130 214 QeEFSDVTLEHMYADNGAMQLLKNPKQFDVIVTDNLFGDILSDEAAMMTGSLGMLPSASLGApdangQR 282 999**********************************************************99999999 PP TIGR00169 270 lalfepvhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseatt 338 +al+epvhgsapdiag+++anp+a++ls a+ lrys+n++e+a+++e+av++vl+ g+rt+d++ + + lcl|FitnessBrowser__azobra:AZOBR_RS14130 283 KALYEPVHGSAPDIAGRDLANPCATLLSFAMCLRYSFNMDEEAKMLEKAVQNVLSGGMRTADIMAPGMA 351 *******************************************************************99 PP TIGR00169 339 avstkeveee 348 + st+ ++++ lcl|FitnessBrowser__azobra:AZOBR_RS14130 352 RCSTTVMGDS 361 9999999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.44 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory