Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate AZOBR_RS02295 AZOBR_RS02295 aspartate aminotransferase
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__azobra:AZOBR_RS02295 Length = 410 Score = 264 bits (674), Expect = 4e-75 Identities = 163/399 (40%), Positives = 215/399 (53%), Gaps = 13/399 (3%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 +N RLD L YPF +L ALL+ P + PI +S+GEP+H PA + + + AN Sbjct: 12 VNDRLDRLSDYPFTRLAALLSGV-TPRANAEPIMMSVGEPQHQPPAIIDETLRANAHLWG 70 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAP--DPESEVLPVLGSREALFAFAQTVIDPSAGA 118 YP G P R+A+ WL+RRY++P D E VLPV G+REALF A + PS Sbjct: 71 KYPPVGGTPEFREAVGAWLARRYALPDGLFDAEKSVLPVSGTREALFLLALLAVPPSKAG 130 Query: 119 ---LVVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSP 175 V+ PNPFY YEGAALLAGA P ++ + F + E+ RT L ++C+P Sbjct: 131 RQPAVLMPNPFYAPYEGAALLAGAEPVFLPSTRETGFLPDLDALTPELLERTALFYLCTP 190 Query: 176 GNPAGNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRL--GRDR 233 NP G L+ R+GF++A ECY+EIYLD+ PP+G+LQ A L G Sbjct: 191 ANPQGAAADAAYLERAIGLARRYGFILAVDECYAEIYLDK--PPVGALQVASGLDHGGKP 248 Query: 234 YTNLVAFSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAW-SM 292 + N++ F SLSKRS+ G+RSGFVAGD L++RF R+Y + M V AAS A W Sbjct: 249 WANILVFHSLSKRSSAAGLRSGFVAGDPELMSRFTRLRSYSNAGMPLPVLAASAALWRDE 308 Query: 293 RRMCRKTAQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPGSDTAFARELYGRTGVTVL 352 + A YRAKF+A L+ P F+LW + A R L+ G+ VL Sbjct: 309 AHVEENRALYRAKFDAAEASLKGRYGYYRPDGGFFLWLEVGDGEEA-TRRLWAEGGIRVL 367 Query: 353 PGSLLAR-EAHNANPGQGRIRIALVAPLDQCVQAAERIA 390 PG+ L R ANPG IRIALV + A IA Sbjct: 368 PGAYLTRCNPGEANPGAPFIRIALVNDAETVAHACSTIA 406 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 583 Number of extensions: 32 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 410 Length adjustment: 31 Effective length of query: 366 Effective length of database: 379 Effective search space: 138714 Effective search space used: 138714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory