Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate AZOBR_RS16945 AZOBR_RS16945 diaminopimelate decarboxylase
Query= reanno::Korea:Ga0059261_2051 (419 letters) >FitnessBrowser__azobra:AZOBR_RS16945 Length = 421 Score = 413 bits (1061), Expect = e-120 Identities = 215/422 (50%), Positives = 283/422 (67%), Gaps = 5/422 (1%) Query: 1 MDHFNRKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSVHLAFAI 60 M F +NGV+HAE+V + IAAEVGTP Y YSTA LE H SA A AG + +A+ Sbjct: 1 MSAFAYRNGVMHAESVPLSTIAAEVGTPFYCYSTAALEAHYSAYAGAFAG-QDADVCYAV 59 Query: 61 KANPNLAVLGVLARQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGI 120 KAN NLAV+ AR G GADVVSGGE++RALA G+PA ++FSGVGKTR E++ L+ GI Sbjct: 60 KANSNLAVIRAFARLGAGADVVSGGEMRRALAGGIPAGKIIFSGVGKTREEMRAALEAGI 119 Query: 121 GQFNLELEEEGEVLADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRAL 180 Q N+E E E L+++A + G TAP RVNPDVDA THAKI+TGK ENKFGV D A Sbjct: 120 HQINVESIPEVEALSEVAVSLGVTAPIAFRVNPDVDAKTHAKIATGKKENKFGVDYDHAR 179 Query: 181 EIFDRLAKRPGLNLRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGG 240 E++ + AK PG+ +A+HIGSQLT+LAP AAY+RV L+ LR GH IT +DLGGG Sbjct: 180 EVYAQAAKLPGIKPVAIAVHIGSQLTDLAPFRAAYERVAALLHVLREDGHDITRLDLGGG 239 Query: 241 LGVPYHAGQTVSTAEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAGN 300 LG+ Y A ++ AMV +T + EPGR + GNAG+LV+ VI++K Sbjct: 240 LGIVYKHEAPPDIA-DYAAMVKSITGNLGCRISLEPGRSLVGNAGILVSRVIYLKQGLHR 298 Query: 301 PYVIVDAAMNDLARPALYDAYHEFEAVEPTGEKFVA---NIAGPVCETGDTFAMGREIDV 357 +VI+DAAMNDL RP LY+AYH V + ++ GPVCE+GDTFA+ R + Sbjct: 299 RFVIIDAAMNDLIRPTLYEAYHGIVPVTEPAKGAATEPYDVVGPVCESGDTFALQRALPA 358 Query: 358 VKSGDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAERVPEW 417 + +L +AGAYGA M+STYN+R L+PEVLV+GD+F+V+ R+ E ++ +RVP+W Sbjct: 359 MAPDELVAILSAGAYGAVMSSTYNTRPLIPEVLVNGDQFSVIRPRVSVEELLALDRVPDW 418 Query: 418 VR 419 ++ Sbjct: 419 LK 420 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 421 Length adjustment: 32 Effective length of query: 387 Effective length of database: 389 Effective search space: 150543 Effective search space used: 150543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS16945 AZOBR_RS16945 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.7777.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-151 488.8 0.0 6.3e-151 488.5 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS16945 AZOBR_RS16945 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS16945 AZOBR_RS16945 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 488.5 0.0 6.3e-151 6.3e-151 5 416 .. 7 413 .. 4 414 .. 0.98 Alignments for each domain: == domain 1 score: 488.5 bits; conditional E-value: 6.3e-151 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeG 73 ++g + +e v+l ++a+e gtP+Y y++++l+++++a++ af+++++ v+YAvKAnsnlav+r +a++G lcl|FitnessBrowser__azobra:AZOBR_RS16945 7 RNGVMHAESVPLSTIAAEVGTPFYCYSTAALEAHYSAYAGAFAGQDADVCYAVKANSNLAVIRAFARLG 75 68999***************************************999********************** PP TIGR01048 74 lgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkka 142 +g+dvvsgGE+ rala g++a ki+fsg+gk++ee++aale++i+ inv+s+ e+e l+e+a +lg +a lcl|FitnessBrowser__azobra:AZOBR_RS16945 76 AGADVVSGGEMRRALAGGIPAGKIIFSGVGKTREEMRAALEAGIHQINVESIPEVEALSEVAVSLGVTA 144 ********************************************************************* PP TIGR01048 143 rvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfvea 211 ++++Rvnpdvdakth +i+TG+ke+KFG+++++a+e+y +a+kl+ +++v i vHIGSq++dl+pf++a lcl|FitnessBrowser__azobra:AZOBR_RS16945 145 PIAFRVNPDVDAKTHAKIATGKKENKFGVDYDHAREVYAQAAKLPGIKPVAIAVHIGSQLTDLAPFRAA 213 ********************************************************************* PP TIGR01048 212 aekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGR 280 e+v+ ll+ l+e+g +++ ldlGGGlgi y++e +pd+++ya++++ ++++ +l ++ lEpGR lcl|FitnessBrowser__azobra:AZOBR_RS16945 214 YERVAALLHVLREDGHDITRLDLGGGLGIVYKHEA-PPDIADYAAMVK-SITG----NLGCRISLEPGR 276 *********************************99.********9976.5555....3899******** PP TIGR01048 281 slvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkr.leeeetetvdvvGplCE 348 slv+nag+l+ rV ++K+ +r+fv++Da+mndliRp lYeayh i+++++ + ++te +dvvGp+CE lcl|FitnessBrowser__azobra:AZOBR_RS16945 277 SLVGNAGILVSRVIYLKQGLHRRFVIIDAAMNDLIRPTLYEAYHGIVPVTEpAKGAATEPYDVVGPVCE 345 ************************************************9984677899*********** PP TIGR01048 349 sgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 sgD++a +r+lp++ +++l+a+ saGAYga mss+Yn+rp + evlv++++ ++ir r ++e+llal+ lcl|FitnessBrowser__azobra:AZOBR_RS16945 346 SGDTFALQRALPAMAPDELVAILSAGAYGAVMSSTYNTRPLIPEVLVNGDQFSVIRPRVSVEELLALD 413 *****************************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.50 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory