Align Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; EC 5.3.1.24; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate AZOBR_RS01680 AZOBR_RS01680 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Query= curated2:P60583 (243 letters) >FitnessBrowser__azobra:AZOBR_RS01680 Length = 249 Score = 152 bits (385), Expect = 5e-42 Identities = 92/240 (38%), Positives = 136/240 (56%), Gaps = 7/240 (2%) Query: 2 LILLPAVDVVDGRAVRLVQGKAGSETEYGSA-LDAALGWQRDGAEWIHLVDLDAAF-GRG 59 +I+ PA+D+ DG VRL++G+ T + + D A ++ G EW+HLVDL+ AF G+ Sbjct: 1 MIIYPAIDLKDGACVRLLRGEMSQATVFNTEPADQARLFESQGFEWLHLVDLNGAFEGKP 60 Query: 60 SNRELLAEVVGKLDVRVELSGGIRDDDSLAAALATGCARVNLGTAALENPQWCARAIGEH 119 N + + ++G + + V+L GGIRD ++A L G +RV LGT AL P+ A E Sbjct: 61 VNGKAVESILGAVAIPVQLGGGIRDLKTIAHWLEKGVSRVILGTVALREPELVREACREF 120 Query: 120 GDKVAVGLDVQIIDGQHRLRGRGW-ETDGGDLWEVLERLERQGCSRYVVTDVTKDGTLGG 178 KVAVG+D + + + GW ET ++ + E G + + TD+ +DG +GG Sbjct: 121 PGKVAVGIDAR----EGYVAVAGWAETSTIKALDLALKFEDSGVAAIIYTDINRDGAMGG 176 Query: 179 PNLDLLGAVADRTDAPVIASGGVSSLDDLRAIATLTGRGVEGAIVGKALYAGRFTLPQAL 238 N++ +A PVIASGGVSS+DDL A+ G+EG I G+ALY GR AL Sbjct: 177 VNVEATSDLAFHLTTPVIASGGVSSIDDLIALKKEEDTGIEGVICGRALYDGRIDPKTAL 236 Lambda K H 0.318 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 249 Length adjustment: 24 Effective length of query: 219 Effective length of database: 225 Effective search space: 49275 Effective search space used: 49275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory