Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate GFF29 Psest_0029 shikimate 5-dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >FitnessBrowser__psRCH2:GFF29 Length = 270 Score = 383 bits (983), Expect = e-111 Identities = 197/272 (72%), Positives = 220/272 (80%), Gaps = 2/272 (0%) Query: 1 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVT 60 MD+Y VFGNPIGHSKSP IH LFA QTGQ L Y LLAPLD+F AR FF+ G G NVT Sbjct: 1 MDRYGVFGNPIGHSKSPQIHALFAAQTGQVLRYEALLAPLDDFVGFARAFFQDGLGANVT 60 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VPFKE+A+R+ D LT RARRAGAVNTL KL DG L GDNTDGAGLV DL ++AGV L G+ Sbjct: 61 VPFKEQAYRMTDQLTERARRAGAVNTLKKLEDGHLLGDNTDGAGLVSDL-LHAGVALRGR 119 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEP 180 RIL+LGAGGAVRG LEP+LA +P +L+IANRTV KAEQLA+EF ELGP+ AS F L EP Sbjct: 120 RILLLGAGGAVRGALEPLLAQRPAALIIANRTVSKAEQLAQEFAELGPLSASTFTDLAEP 179 Query: 181 VDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLG 240 VD+IIN TSASL GELPP+ADSL++ G T CYDMMY +PT FCQWA LG A DGLG Sbjct: 180 VDLIINGTSASLGGELPPLADSLIQPGHTFCYDMMYAAKPTAFCQWAAALG-ADTRDGLG 238 Query: 241 MLAEQAAEAFFIWRGVRPDTAPVLAELRRQLA 272 ML EQAAEAF +WRGVRPDTAPVLAELRRQL+ Sbjct: 239 MLVEQAAEAFELWRGVRPDTAPVLAELRRQLS 270 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 270 Length adjustment: 25 Effective length of query: 249 Effective length of database: 245 Effective search space: 61005 Effective search space used: 61005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate GFF29 Psest_0029 (shikimate 5-dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.27229.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-83 263.8 0.0 8.3e-83 263.6 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF29 Psest_0029 shikimate 5-dehydroge Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF29 Psest_0029 shikimate 5-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.6 0.0 8.3e-83 8.3e-83 3 269 .. 4 269 .. 2 270 .] 0.95 Alignments for each domain: == domain 1 score: 263.6 bits; conditional E-value: 8.3e-83 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeieesak 79 +gv+Gnpi hSksp ih +++q+g+ l+Y a+ ++++++ + ++++ gl G+nvTvPfKe+++++ D+++e+a+ lcl|FitnessBrowser__psRCH2:GFF29 4 YGVFGNPIGHSKSPQIHALFAAQTGQVLRYEALLAPLDDFVGFARAFFQDGL-GANVTVPFKEQAYRMTDQLTERAR 79 9***********************************************9996.************************ PP TIGR00507 80 ligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.dkeviiaNRtveka 153 +gavNTlk ledg+l+g+nTDg Glvs+L + l+ ++r+l++GAGGa ++++ +Ll + + ++iiaNRtv+ka lcl|FitnessBrowser__psRCH2:GFF29 80 RAGAVNTLKkLEDGHLLGDNTDGAGLVSDLLHaGVALR-GRRILLLGAGGAVRGALEPLLAQrPAALIIANRTVSKA 155 *********9*********************9556666.*******************9988799************ PP TIGR00507 154 eelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellkegk.lvvDlvynpletpllkeakkk 229 e+la++++elg a ++ + vdliin tsa+l ge+ +++ +l++ g+ +++D++y+ + t++ ++a + lcl|FitnessBrowser__psRCH2:GFF29 156 EQLAQEFAELGPLSASTFTDLA-EPVDLIINGTSASLGGEL--PPLADSLIQPGHtFCYDMMYAAKPTAFCQWAAAL 229 ***********99998877664.45****************..9******998752689****************** PP TIGR00507 230 gtkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 g+ + dGlgMlv+Qaa +Felw+gv pd v l+++l lcl|FitnessBrowser__psRCH2:GFF29 230 GADTRDGLGMLVEQAAEAFELWRGVRPDTAPVLAELRRQL 269 *******************************999998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (270 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.29 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory