Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate 209219 DVU0285 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
Query= reanno::DvH:209219 (213 letters) >MicrobesOnline__882:209219 Length = 213 Score = 449 bits (1155), Expect = e-131 Identities = 213/213 (100%), Positives = 213/213 (100%) Query: 1 MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTG 60 MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTG Sbjct: 1 MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTG 60 Query: 61 LDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIR 120 LDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIR Sbjct: 61 LDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIR 120 Query: 121 VPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPG 180 VPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPG Sbjct: 121 VPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPG 180 Query: 181 LWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ 213 LWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ Sbjct: 181 LWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ 213 Lambda K H 0.322 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 213 Length adjustment: 22 Effective length of query: 191 Effective length of database: 191 Effective search space: 36481 Effective search space used: 36481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 209219 DVU0285 (imidazole glycerol phosphate synthase, glutamine amidotransferase subunit)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.29531.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-60 189.4 0.0 3.5e-60 189.2 0.0 1.0 1 lcl|MicrobesOnline__882:209219 DVU0285 imidazole glycerol phosp Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:209219 DVU0285 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 189.2 0.0 3.5e-60 3.5e-60 2 197 .. 3 204 .. 2 205 .. 0.96 Alignments for each domain: == domain 1 score: 189.2 bits; conditional E-value: 3.5e-60 TIGR01855 2 vvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvvkkkkpvlgiClG 80 +++dy++gN +sv++al+++g ++++d + ++ a +++PGVGa+ +am++l ++l+ + +++v++++p+lgiC+G lcl|MicrobesOnline__882:209219 3 AILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTGLDEVLRRQVQAGRPLLGICVG 81 79********************************************************998889*************** PP TIGR01855 81 mQllfekseEgkevkglglikgkvkkleaek........kvPhiGWnevevvkesellkgleeearvYfvHsYavelee 151 Q++++ s+E +++k+lg+i+g+ + ++ + +vPh+GWn++ + +ellkg+e ea++YfvHsY+ + e lcl|MicrobesOnline__882:209219 82 CQIMLDYSQE-NDTKALGIIPGECRLFNPAWtdedgapiRVPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPE 159 **********.579*************987667789999***********************************99987 PP TIGR01855 152 eeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllknfle 197 e+v+a+++yg++f a+ + +vQFHPEkSg+ Gl+ll nf + lcl|MicrobesOnline__882:209219 160 -EYVIATCTYGAEFCAIHGGPGLWAVQFHPEKSGRPGLRLLANFHR 204 .8*****************************************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (213 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 5.94 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory