Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 (characterized)
to candidate 207334 DVU1868 dihydrodipicolinate synthase
Query= SwissProt::Q07607 (292 letters) >MicrobesOnline__882:207334 Length = 292 Score = 297 bits (761), Expect = 2e-85 Identities = 151/290 (52%), Positives = 197/290 (67%) Query: 2 FEGSITALVTPFADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVEI 61 F G+ TA+VTPF + R+DE +L+EWQIE+G GLVPCGTTGES TLS EH V+ I Sbjct: 3 FTGAFTAIVTPFRNGRVDEERFRELIEWQIEQGINGLVPCGTTGESATLSHDEHRDVIRI 62 Query: 62 TIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFKAI 121 ++ GR+PV+AGAGSN+T EAI R A+ AGADG L+++PYYNKPTQEG+Y HFKAI Sbjct: 63 CVEQVKGRIPVLAGAGSNNTREAIDLTRFAKEAGADGALLITPYYNKPTQEGLYLHFKAI 122 Query: 122 DAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVKDATGNLLRPSLERMACGEDF 181 + ++P IVYN+P R+ I ETLAR+ D P V GVK+ATGNL++ S CG DF Sbjct: 123 ASEVSMPFIVYNVPSRTGTNICPETLARLNRDIPEVVGVKEATGNLIQVSEILEYCGTDF 182 Query: 182 NLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMPLHR 241 +L+G+D T L ++ GG G ISVT+NV PA +D +A GD A A +L L P++R Sbjct: 183 QVLSGDDFTVLPLLSVGGCGVISVTSNVVPAKMSDMCRAFKAGDLATARRLHFELSPINR 242 Query: 242 ALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDDAMRHAGIL 291 A+FLETNP K AL +GR+ ++RLPL + Q + D + AGIL Sbjct: 243 AMFLETNPIPVKTALALMGRIDLEMRLPLCPLQQVNQSRLRDILAAAGIL 292 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 292 Length adjustment: 26 Effective length of query: 266 Effective length of database: 266 Effective search space: 70756 Effective search space used: 70756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 207334 DVU1868 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.24317.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-116 373.9 0.0 2.1e-116 373.7 0.0 1.0 1 lcl|MicrobesOnline__882:207334 DVU1868 dihydrodipicolinate synt Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:207334 DVU1868 dihydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 373.7 0.0 2.1e-116 2.1e-116 2 284 .. 6 287 .. 5 289 .. 0.99 Alignments for each domain: == domain 1 score: 373.7 bits; conditional E-value: 2.1e-116 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgsnate 80 tA++TPf++ vd + + +lie qie+g++++v++GtTGEsatLs++E+ +vi++ ve vk+r+pv+aG+gsn+t+ lcl|MicrobesOnline__882:207334 6 AFTAIVTPFRNGR-VDEERFRELIEWQIEQGINGLVPCGTTGESATLSHDEHRDVIRICVEQVKGRIPVLAGAGSNNTR 83 579******9988.***************************************************************** PP TIGR00674 81 eaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaeeve.ivaiK 158 eai+lt++a+++g+dg+l++tPyYnkPtqeGly hfkaia+ev++P i+YnvPsRtg+++ pet++rL ++ + +v++K lcl|MicrobesOnline__882:207334 84 EAIDLTRFAKEAGADGALLITPYYNKPTQEGLYLHFKAIASEVSMPFIVYNVPSRTGTNICPETLARLNRDIPeVVGVK 162 *********************************************************************99888***** PP TIGR00674 159 easgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteeareihqkllklf 237 ea+g+l +vsei ++ + df+vlsGdD ++l++l++G++GviSV+snv+p ++++m++a+ +gd + ar +h +l ++ lcl|MicrobesOnline__882:207334 163 EATGNLIQVSEILEYCGTDFQVLSGDDFTVLPLLSVGGCGVISVTSNVVPAKMSDMCRAFKAGDLATARRLHFELSPIN 241 ******************************************************************************* PP TIGR00674 238 kalfietNPipvKtalallgliekdelRlPLtelseekkeklkevlk 284 +a+f+etNPipvKtalal+g i e+RlPL++l++ ++++l+++l+ lcl|MicrobesOnline__882:207334 242 RAMFLETNPIPVKTALALMGRIDL-EMRLPLCPLQQVNQSRLRDILA 287 ************************.*******************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory