Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate 209013 DVU0085 tryptophan synthase, beta subunit
Query= uniprot:P50383 (425 letters) >MicrobesOnline__882:209013 Length = 414 Score = 123 bits (309), Expect = 9e-33 Identities = 118/373 (31%), Positives = 160/373 (42%), Gaps = 62/373 (16%) Query: 73 GRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTETG 132 GR TPLF L L ARIY K E G+HK+N I Q AK G + V+ ETG Sbjct: 63 GRATPLFLCSNLTARLGG-ARIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKVIAETG 121 Query: 133 AGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKIL 192 AGQ G A A A++ M+ TI+M E++ + M++ GA V + + G++ L Sbjct: 122 AGQHGVATAATAALMGMQCTIYMGAEDMERQKLNVFRMRMMGAEVVPAMS-----GQRTL 176 Query: 193 ETNPQHPGSLGIAMSEAIEYAL------KNEFRYLVGSVLD------VVLLHQSVIGQET 240 + EA++ AL NE YL+GS + +V QSVIG+E Sbjct: 177 K--------------EAVDEALAAWVQDANETFYLLGSAVGPHPYPAIVRHFQSVIGREA 222 Query: 241 ITQ-LDLLGEDADILIGCVGGGSNFGGFTYPFIGNK-----------KGKRY---IAVSS 285 Q L+ G D I CVGGGSN G F+ + +G Y A Sbjct: 223 RAQILEAEGRLPDCCIACVGGGSNAIGLFAEFVPDTSVRLIGVEPAGRGLTYGDHAATLC 282 Query: 286 AEIPKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEG 345 P G Y Y D G V I+ G D Y GV P S L Sbjct: 283 LGEPGVLHGFYSYMLKDDKGEAAAVYSISAGLD------------YPGVGPEHSHLKDMN 330 Query: 346 IVEWREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSG 405 E+ + E +A +GI+PA ES+HA+ + A K+ +IV NLSG Sbjct: 331 RAEYVSVTDVEAVDAFFTLSRAEGIIPALESSHALAHAMKMAPAMPKD---AIIVVNLSG 387 Query: 406 HGLLDLSNYESMM 418 G D++ E M+ Sbjct: 388 RGDKDVAQIEEMV 400 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 414 Length adjustment: 32 Effective length of query: 393 Effective length of database: 382 Effective search space: 150126 Effective search space used: 150126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 209013 DVU0085 (tryptophan synthase, beta subunit)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.1434.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-186 605.6 0.1 2.2e-186 605.4 0.1 1.0 1 lcl|MicrobesOnline__882:209013 DVU0085 tryptophan synthase, bet Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:209013 DVU0085 tryptophan synthase, beta subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 605.4 0.1 2.2e-186 2.2e-186 1 383 [. 16 398 .. 16 400 .. 0.99 Alignments for each domain: == domain 1 score: 605.4 bits; conditional E-value: 2.2e-186 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkredllhtG 79 g+fg++GGq+vp++l + l++l ++++ k+d++f +e++++l +y+gr+tpl+ ++nl+ +lgga+iylkredl+h G lcl|MicrobesOnline__882:209013 16 GFFGAYGGQFVPDQLKPILDDLAATFDACKDDPSFIEEFTYYLTRYSGRATPLFLCSNLTARLGGARIYLKREDLNHLG 94 68***************************************************************************** PP TIGR00263 80 ahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmellgakvvpvtsGs 158 ahk+nn++gq+llakr+Gkk++iaetGaGqhGvata+ aal+g++c++ymGaed+erqklnvfrm+++ga+vvp sG+ lcl|MicrobesOnline__882:209013 95 AHKVNNTIGQILLAKRMGKKKVIAETGAGQHGVATAATAALMGMQCTIYMGAEDMERQKLNVFRMRMMGAEVVPAMSGQ 173 ******************************************************************************* PP TIGR00263 159 ktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlPdaviacvGGGsnaiGifa 237 +tlk+av+eal +Wv + ++t+y+lGsavGphP+P+ivr+fqsvig+e+++qile+egrlPd iacvGGGsnaiG+fa lcl|MicrobesOnline__882:209013 174 RTLKEAVDEALAAWVQDANETFYLLGSAVGPHPYPAIVRHFQSVIGREARAQILEAEGRLPDCCIACVGGGSNAIGLFA 252 ******************************************************************************* PP TIGR00263 238 afiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypgvgPehaalaetgr 316 +f+ d +v+ligve++G+G+ +haatl G++GvlhG+++++l+d++G+ ++s+saGldypgvgPeh++l++ +r lcl|MicrobesOnline__882:209013 253 EFVPDTSVRLIGVEPAGRGLTYGDHAATLCLGEPGVLHGFYSYMLKDDKGEAAAVYSISAGLDYPGVGPEHSHLKDMNR 331 ******************************************************************************* PP TIGR00263 317 aeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeivvvnlsGrGdkdletvak 383 aey+++td ea++a+ +ls+ eGiipalesshala+++k+ap+++kd+i+vvnlsGrGdkd++++ + lcl|MicrobesOnline__882:209013 332 AEYVSVTDVEAVDAFFTLSRAEGIIPALESSHALAHAMKMAPAMPKDAIIVVNLSGRGDKDVAQIEE 398 ****************************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (414 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.50 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory