Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate 209403 DVU0467 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >MicrobesOnline__882:209403 Length = 332 Score = 209 bits (532), Expect = 8e-59 Identities = 128/316 (40%), Positives = 174/316 (55%), Gaps = 3/316 (0%) Query: 20 HDEMVDL-MRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMREFSRRVEVTDRRH 78 H EM +M G+++ A + L GLR+K ET E+ A + V D Sbjct: 18 HPEMAGAGFASLMDGDMTPAQAGSFLMGLRMKGETADEMTEAVRAALARAVTVRGVDAPS 77 Query: 79 MVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSGSADALEALGAVIELQ 138 +DIVGTGGDG +FN ST A G KV KHGNR+VSS GSADA+E LG +E+ Sbjct: 78 -IDIVGTGGDGRSSFNCSTATALTLAGMGHKVVKHGNRAVSSSCGSADAIEGLGLPLEVD 136 Query: 139 PEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPLTNPAGSPNILMGV 198 V A L + G F++AP HPA + V P+RRE+GVRT+FN+LGPL NPA ++L+GV Sbjct: 137 AADVPAMLHERGFAFLFAPRFHPAFRHVMPIRRELGVRTLFNLLGPLLNPARPTHMLLGV 196 Query: 199 FHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDGQVHEYEVHPEDFG 258 L+ + A L+ GA RA VV+G G DEL+ V LRDG V E+EV P +G Sbjct: 197 ARESLMPLMAETLRRTGAARAAVVFGAGGYDELTPLGPARVLFLRDGIVSEHEVDPARYG 256 Query: 259 IAMSASRNLKVADAAESRAMLLQVLDNV-PGPALDIVALNAGAALYVAGVADSIADGIVR 317 IA +L V D E+ +L ++L P D++ N G AL++ + D + Sbjct: 257 IAPCTPEDLVVRDREEAVRVLRELLSGAGPQAMRDMLVFNVGMALHLLHDDRPLEDCMNE 316 Query: 318 ARQVLADGSARACLDA 333 AR+ + G+ R L A Sbjct: 317 ARRAVHAGAGRKVLHA 332 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 332 Length adjustment: 28 Effective length of query: 317 Effective length of database: 304 Effective search space: 96368 Effective search space used: 96368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 209403 DVU0467 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.28937.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-105 338.8 0.0 2.1e-105 338.7 0.0 1.0 1 lcl|MicrobesOnline__882:209403 DVU0467 anthranilate phosphoribo Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:209403 DVU0467 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 338.7 0.0 2.1e-105 2.1e-105 2 324 .. 9 330 .. 8 332 .] 0.98 Alignments for each domain: == domain 1 score: 338.7 bits; conditional E-value: 2.1e-105 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDivGTGGD 80 e+l+++ dL+ e a + + +m+g++++aq +++l+ lr+kget++e++++++a +++a++v+ ++ +DivGTGGD lcl|MicrobesOnline__882:209403 9 ETLATGCDLHPEMAGAGFASLMDGDMTPAQAGSFLMGLRMKGETADEMTEAVRAALARAVTVRG-VDAPSIDIVGTGGD 86 7788999999999*************************************************99.79************ PP TIGR01245 81 glktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPkyhpalkeva 159 g +++N STa+al +a++G kv+KhGnr+vss++GsaD +e lg+ le++++ v ++l+e g++FlfAP++hpa+++v+ lcl|MicrobesOnline__882:209403 87 GRSSFNCSTATALTLAGMGHKVVKHGNRAVSSSCGSADAIEGLGLPLEVDAADVPAMLHERGFAFLFAPRFHPAFRHVM 165 ******************************************************************************* PP TIGR01245 160 pvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisltgetkvaelkdge 238 p+R+eLgvrt+fNlLGPLlnPar+++ +lGv++++l+ ++ae+l++ g+ ra vv g++g DE+++ g+++v+ l+dg lcl|MicrobesOnline__882:209403 166 PIRRELGVRTLFNLLGPLLNPARPTHMLLGVARESLMPLMAETLRRTGAARAAVVFGAGGYDELTPLGPARVLFLRDGI 244 ******************************************************************************* PP TIGR01245 239 ieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegvelakeaiks 317 ++e +++p+ +g+++++ e+l + + ee +++l+e+l+g + +a rd++v+N+++al + + + l++ ++ a++a++ lcl|MicrobesOnline__882:209403 245 VSEHEVDPARYGIAPCTPEDLVVRDREEAVRVLRELLSGAGPQAMRDMLVFNVGMALHLLHDDRPLEDCMNEARRAVHA 323 ******************************************************************************* PP TIGR01245 318 gkalekl 324 g+ ++l lcl|MicrobesOnline__882:209403 324 GAGRKVL 330 *998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (332 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.22 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory