Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_011386279.1 AMB_RS19865 3-dehydroquinate synthase
Query= BRENDA::P07639 (362 letters) >NCBI__GCF_000009985.1:WP_011386279.1 Length = 371 Score = 313 bits (801), Expect = 6e-90 Identities = 175/364 (48%), Positives = 228/364 (62%), Gaps = 4/364 (1%) Query: 2 ERIVVTLGERSYPITIASGLFNEPASFL-PLKSGEQVMLVTNETLAPLYLDKVRGVLEQA 60 E ++V LGERSYPI I GL + + P G + ++VT+ +AP YL++V+ L +A Sbjct: 6 EEVMVELGERSYPIHIGPGLLDRAGELIKPKMRGGRALVVTDANVAPHYLERVQKSLAEA 65 Query: 61 GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR 120 GV ++P GEQ K L+ + A+L+ R +VALGGGVVGDLTGFAA+ R Sbjct: 66 GVTTMHTVMPAGEQTKDFKHLEALLDAMLEARSERGIMVVALGGGVVGDLTGFAASILLR 125 Query: 121 GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS 180 GV F+Q+PTTLLSQVDSSVGGKT +N GKN+IG+FYQP V+ D L TLP R++ + Sbjct: 126 GVDFVQIPTTLLSQVDSSVGGKTGINTRQGKNLIGSFYQPRLVLADTSVLNTLPRRQVLA 185 Query: 181 GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR 240 G AEV KYG+I D FF WLEEN ++ D A Y + C KA +V ADERE G+R Sbjct: 186 GYAEVAKYGVIDDEPFFAWLEENGSKVVDGDLEARRYAVATSCRAKARIVGADEREGGVR 245 Query: 241 ALLNLGHTFGHAIEAEMGYG-NWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKR 299 ALLNLGHTFGHA+EAE G+ LHGEAVA GMVMA R S RLG +A+ +R+ L Sbjct: 246 ALLNLGHTFGHALEAETGFSEEMLHGEAVAIGMVMALRLSARLGLAPAADAERLERHLLA 305 Query: 300 AGLPVN--GPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIA 357 GLPV PR + + HM DKKV G++ ++ IGKS + V + + +A Sbjct: 306 VGLPVTLPKPRLWAVDRLIHHMAGDKKVKDGKVTFVMAKGIGKSFLTRDVPEAELASMLA 365 Query: 358 DCQS 361 + S Sbjct: 366 EMAS 369 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 371 Length adjustment: 30 Effective length of query: 332 Effective length of database: 341 Effective search space: 113212 Effective search space used: 113212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011386279.1 AMB_RS19865 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.13962.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-119 385.2 0.0 1.6e-119 385.0 0.0 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011386279.1 AMB_RS19865 3-dehydroquinate syn Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011386279.1 AMB_RS19865 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.0 0.0 1.6e-119 1.6e-119 1 340 [. 17 361 .. 17 365 .. 0.97 Alignments for each domain: == domain 1 score: 385.0 bits; conditional E-value: 1.6e-119 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKslet 67 y++++g gll+++ e ++ + +++v+td +v+ ++ e++++ l+++gv++++ v+p+ge++K++++ lcl|NCBI__GCF_000009985.1:WP_011386279.1 17 YPIHIGPGLLDRAGELIKPkmRGGRALVVTDANVAPHYLERVQKSLAEAGVTTMHTVMPAGEQTKDFKH 85 689**************99644499******************************************** PP TIGR01357 68 vaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlpl 136 +++lld++le+ er ++va+GGGvvgDl+GF+A++ lRG+++vq+PTtll++vDssvGGKtgin+++ lcl|NCBI__GCF_000009985.1:WP_011386279.1 86 LEALLDAMLEARSERGIMVVALGGGVVGDLTGFAASILLRGVDFVQIPTTLLSQVDSSVGGKTGINTRQ 154 ********************************************************************* PP TIGR01357 137 gkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealee 205 gkNliG+fyqP++Vl d++vl+tlp+r++ +G+aEv K+g+i d+ +f++le+n +++++ +lea + lcl|NCBI__GCF_000009985.1:WP_011386279.1 155 GKNLIGSFYQPRLVLADTSVLNTLPRRQVLAGYAEVAKYGVIDDEPFFAWLEENGSKVVD-GDLEARRY 222 ********************************************************9997.578***** PP TIGR01357 206 likrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk..lsHGeaVaiGmvveaklseklgll 272 +++ s++ Ka++V +De+e g+RalLN+GHt+gHa+Ea+++++ + HGeaVaiGmv++++ls +lgl+ lcl|NCBI__GCF_000009985.1:WP_011386279.1 223 AVATSCRAKARIVGADEREGGVRALLNLGHTFGHALEAETGFSeeMLHGEAVAIGMVMALRLSARLGLA 291 ****************************************99999************************ PP TIGR01357 273 kaellerlvallkklglptklkk..klsveellkallkDKKnegskiklvlleeiGkaalasevteeel 339 +a ++erl++ l ++glp++l+k ++v+ l++++ DKK +++k+++v+++ iGk +l+++v+e el lcl|NCBI__GCF_000009985.1:WP_011386279.1 292 PAADAERLERHLLAVGLPVTLPKprLWAVDRLIHHMAGDKKVKDGKVTFVMAKGIGKSFLTRDVPEAEL 360 **********************99899*********************************999988776 PP TIGR01357 340 l 340 lcl|NCBI__GCF_000009985.1:WP_011386279.1 361 A 361 5 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.89 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory