Align 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 (characterized)
to candidate Echvi_0478 Echvi_0478 6-phosphogluconate dehydrogenase, decarboxylating
Query= SwissProt::P70718 (484 letters) >FitnessBrowser__Cola:Echvi_0478 Length = 636 Score = 350 bits (897), Expect = e-100 Identities = 179/468 (38%), Positives = 279/468 (59%), Gaps = 11/468 (2%) Query: 8 GVIGLAVMGQNLILNMNDHGFKVVAYNRTTSKVDE-----FLEGAAKGTNIIGAYSLEDL 62 G+IG+ VMG +L LN+ + K+ YNRT V+E ++ + I+ L++ Sbjct: 168 GIIGMGVMGSSLALNLAEKDVKISVYNRTLQGVEEDVAQKLVDAHPEVKGILPFDKLDEF 227 Query: 63 ANKLEKPRKVMLMVRAGEVVDHFIDALLPHLEAGDIIIDGGNSNYPDTNRRVAALREKGI 122 LE+PRK+++M+ AG++VD I LL ++ GD+IIDGGNS + D+ +R L+ GI Sbjct: 228 VESLEQPRKILMMIPAGQIVDQQIARLLTFVDKGDVIIDGGNSFFEDSAKRQQYLQGYGI 287 Query: 123 RFIGTGVSGGEEGARHGPSIMPGGNEEAWQFVKPVLQAISAKTEQGEPCCDWVGKDGAGH 182 F+G G+SGG +GA GPS+MPGG+EE ++ +KP L+ I+ K + G+PC +VG DGAGH Sbjct: 288 HFVGMGISGGRDGALKGPSLMPGGSEEGFELIKPYLEKIAGKDKGGKPCMHYVGPDGAGH 347 Query: 183 FVKMVHNGIEYGDMQLICEAYQFLKEGVGLSDDELQATFNEWRNTELDSYLIDITADILG 242 F+KMVHN IEYG++Q++ E Y F+++G+G+S +E+ TF W DSYL+D T IL Sbjct: 348 FIKMVHNSIEYGEIQVLAELYGFMRKGLGMSIEEMVKTFKTWSKEGADSYLMDATLAILS 407 Query: 243 YKDADGSRLVDKVLDTAGQKGTGKWTGINALDFGIPLTLITESVFARCVSAFKDQRVAAS 302 + + DG L+D +LD AGQ GTG W A +G+P +T +V AR VS K+ RV+ + Sbjct: 408 H-EKDGKLLLDGILDVAGQTGTGGWAVSTAAKYGVPYAPLTAAVTARLVSTHKEARVSFA 466 Query: 303 KLFHKTIGKVEGDKKVWIEAVRKALLASKIISYAQGFMLIREASEHFNWNINYGNTALLW 362 + + + ++ D+K I+A++ A ++++++ GF LI++ E W +N A W Sbjct: 467 QTYPRKTDEI--DQKEIIDALKGAYDMARLVNHEIGFSLIKKVGEAEKWGLNMSEIARCW 524 Query: 363 REGCIIRSRFLGNIRDAYEANPDLIFLGSDSYFKGILENAMSDWRKVVAKSIEVGIPMPC 422 G II+S + + +++ L+ + + K EN +VV ++ GI MP Sbjct: 525 TNGSIIQSSLMEKLAGVFKSTDCLM---ASAALKASFENGAKTLAEVVGAGLKAGIAMPV 581 Query: 423 MASAITFLDGYTSARLPANLLQAQRDYFGAHTYERTDKPRGEFFHTNW 470 M++AI F G +S + ANL+QA RD FG H Y D G+ W Sbjct: 582 MSAAINFFYGMSSGQSSANLVQALRDCFGEHGYRLVDDVSGKIHRNKW 629 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 796 Number of extensions: 40 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 636 Length adjustment: 36 Effective length of query: 448 Effective length of database: 600 Effective search space: 268800 Effective search space used: 268800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate Echvi_0478 Echvi_0478 (6-phosphogluconate dehydrogenase, decarboxylating)
to HMM TIGR00873 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00873.hmm # target sequence database: /tmp/gapView.28284.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00873 [M=467] Accession: TIGR00873 Description: gnd: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-146 472.9 0.6 7.1e-146 472.6 0.6 1.1 1 lcl|FitnessBrowser__Cola:Echvi_0478 Echvi_0478 6-phosphogluconate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0478 Echvi_0478 6-phosphogluconate dehydrogenase, decarboxylating # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.6 0.6 7.1e-146 7.1e-146 2 466 .. 167 630 .. 166 631 .. 0.95 Alignments for each domain: == domain 1 score: 472.6 bits; conditional E-value: 7.1e-146 TIGR00873 2 iGliGlavmGknlvlniadkGfsvavynrtkektd.....ellkeeakgkklvgaesieefvkslekPrkilll 70 +G+iG++vmG+ l+ln+a+k +++vynrt + ++ +l+ + + k + ++ +++efv+sle+Prkil++ lcl|FitnessBrowser__Cola:Echvi_0478 167 FGIIGMGVMGSSLALNLAEKDVKISVYNRTLQGVEedvaqKLVDAHPEVKGILPFDKLDEFVESLEQPRKILMM 240 8****************************9776651111157777888999*********************** PP TIGR00873 71 vkaGaavdavieellpllekgdiiidGGnslykdterrekelkekgilfvGvGvsGGeeGarkGPslmpGGske 144 + aG+ vd+ i++ll +++kgd+iidGGns+++d+ +r++ l+ gi+fvG+G+sGG +Ga+kGPslmpGGs+e lcl|FitnessBrowser__Cola:Echvi_0478 241 IPAGQIVDQQIARLLTFVDKGDVIIDGGNSFFEDSAKRQQYLQGYGIHFVGMGISGGRDGALKGPSLMPGGSEE 314 ************************************************************************** PP TIGR00873 145 ayelvepilqkiaakve.gepcceyiGedGaGhyvkmvhnGieygdmqliaeayellkealklsaeeiaevfee 217 +el++p l+kia k + g+pc++y+G+dGaGh++kmvhn ieyg++q++ae y +++++l++s ee+ ++f++ lcl|FitnessBrowser__Cola:Echvi_0478 315 GFELIKPYLEKIAGKDKgGKPCMHYVGPDGAGHFIKMVHNSIEYGEIQVLAELYGFMRKGLGMSIEEMVKTFKT 388 ***************9999******************************************************* PP TIGR00873 218 WnegeldsylieitadilkkkdedGkplvdkildaagqkGtGkWtaidaldlGvPvtlitesvfarvlsslkee 291 W ++ dsyl++ t +il++ ++dGk l+d ild+agq GtG W++ a + GvP + +t++v ar++s+ ke+ lcl|FitnessBrowser__Cola:Echvi_0478 389 WSKEGADSYLMDATLAILSH-EKDGKLLLDGILDVAGQTGTGGWAVSTAAKYGVPYAPLTAAVTARLVSTHKEA 461 ******************86.689************************************************** PP TIGR00873 292 rvaaskllsgplaeekaedkeefiedvrealyaskivsyaqGfallkeaskeygwdlnlgeialiwrgGciirs 365 rv +++++ ++ + d++e i++++ a ++++v + Gf+l+k++ + w ln++eia+ w +G ii+s lcl|FitnessBrowser__Cola:Echvi_0478 462 RVSFAQTYPRKTD---EIDQKEIIDALKGAYDMARLVNHEIGFSLIKKVGEAEKWGLNMSEIARCWTNGSIIQS 532 ***9999987654...35889***************************************************** PP TIGR00873 366 kfldkikkafeenpelenlllaeyfkdalkkaqkglrkvvakaielgipvPalsaalsfydgyrtarlpanllq 439 ++++k+ f++ l+ + +k + ++ k+l +vv + ++gi++P +saa++f+ g+++ +++anl+q lcl|FitnessBrowser__Cola:Echvi_0478 533 SLMEKLAGVFKST---DCLMASAALKASFENGAKTLAEVVGAGLKAGIAMPVMSAAINFFYGMSSGQSSANLVQ 603 **********975...578889999999********************************************** PP TIGR00873 440 aqrdyfGahtyertdkprgeffhteWl 466 a+rd fG h+y+ d g+ + +W lcl|FitnessBrowser__Cola:Echvi_0478 604 ALRDCFGEHGYRLVDDVSGKIHRNKWR 630 ****************99999999996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (467 nodes) Target sequences: 1 (636 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 11.26 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory