Align Ornithine aminotransferase; OAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate AZOBR_RS19590 AZOBR_RS19590 ornithine-oxoacid aminotransferase
Query= SwissProt::P38021 (401 letters) >FitnessBrowser__azobra:AZOBR_RS19590 Length = 405 Score = 452 bits (1164), Expect = e-132 Identities = 219/398 (55%), Positives = 283/398 (71%), Gaps = 3/398 (0%) Query: 4 LSKSKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPK 63 L + ++I GA+NY PL +V++ G +V D EGN Y+D LSAYSAVNQGH HPK Sbjct: 2 LQHAADLIGTEHRLGAHNYKPLDVVLARGEGVYVWDTEGNRYLDCLSAYSAVNQGHCHPK 61 Query: 64 IIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRW 123 I++A+ QA K+TLTSRAF NDQL FYE+ A LTG ILPMN+GAEAVESA+K R+W Sbjct: 62 ILEAMVQQASKLTLTSRAFRNDQLALFYEELAALTGSHKILPMNSGAEAVESAIKTVRKW 121 Query: 124 AYEVKGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALR 183 YEV+GV +NQAEII C NFHGRT+ VS S++ + + GFGP PG + +P+GD AL Sbjct: 122 GYEVRGVPENQAEIIVCSDNFHGRTISIVSFSTDPDARGGFGPFTPGFRTVPFGDAAALE 181 Query: 184 QAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFA 243 A+TPNT A L EPIQGEAG+VIPP G+L+ +C E NV+ I DEIQTGLGRTGK A Sbjct: 182 AALTPNTVAVLLEPIQGEAGVVIPPAGYLRRVRDLCTERNVVMILDEIQTGLGRTGKLLA 241 Query: 244 CDWDGIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASL 303 + +G+ D+ ++GKAL GG +P+S + ++ E+LGV PG HGSTFGGNPLACAV+ A++ Sbjct: 242 EEHEGVEADVTLIGKALSGGFYPVSAVLSNSEVLGVLKPGQHGSTFGGNPLACAVARAAM 301 Query: 304 EVLEDEKLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIGVEL---TEAARPYCERLK 360 VL +E + D + G YF +L +I S VI+E RGRGL + VEL AR YCE L+ Sbjct: 302 RVLVEEGMIDNAAAQGAYFLEQLGAIRSNVIREARGRGLMLAVELHPEAGGARRYCEALR 361 Query: 361 EEGLLCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVL 398 G+L K+THD IR APPL+I++E +DWA+E+ VL Sbjct: 362 ARGVLAKDTHDHTIRIAPPLVITREQVDWALEQFDAVL 399 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 405 Length adjustment: 31 Effective length of query: 370 Effective length of database: 374 Effective search space: 138380 Effective search space used: 138380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS19590 AZOBR_RS19590 (ornithine-oxoacid aminotransferase)
to HMM TIGR01885 (rocD: ornithine--oxo-acid transaminase (EC 2.6.1.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01885.hmm # target sequence database: /tmp/gapView.23794.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01885 [M=402] Accession: TIGR01885 Description: Orn_aminotrans: ornithine--oxo-acid transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-167 542.5 0.0 3.1e-167 542.3 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS19590 AZOBR_RS19590 ornithine-oxoacid Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS19590 AZOBR_RS19590 ornithine-oxoacid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.3 0.0 3.1e-167 3.1e-167 3 400 .. 7 398 .. 5 400 .. 0.98 Alignments for each domain: == domain 1 score: 542.3 bits; conditional E-value: 3.1e-167 TIGR01885 3 evieleekygahnyhplpvvlskaeGakvwdvegkryldflsaysavnqGhchpkivkalveqaqkltl 71 ++i +e++ gahny+pl+vvl+++eG++vwd+eg+ryld lsaysavnqGhchpki++a+v+qa+kltl lcl|FitnessBrowser__azobra:AZOBR_RS19590 7 DLIGTEHRLGAHNYKPLDVVLARGEGVYVWDTEGNRYLDCLSAYSAVNQGHCHPKILEAMVQQASKLTL 75 67899**************************************************************** PP TIGR01885 72 ssrafyndvfgefaeyvtklfGydkvlpmntGaeavetaiklarkWgykkkkipedkalilsaegnfhG 140 +sraf nd+++ f e ++ l G k+lpmn+Gaeave+aik +rkWgy+++++pe++a i+++++nfhG lcl|FitnessBrowser__azobra:AZOBR_RS19590 76 TSRAFRNDQLALFYEELAALTGSHKILPMNSGAEAVESAIKTVRKWGYEVRGVPENQAEIIVCSDNFHG 144 ********************************************************************* PP TIGR01885 141 rtlavislstdpesrenfGpyvpnvkkieynnlealeealeeagekvaaflvePiqGeaGvvvpddgyl 209 rt++++s stdp++r +fGp++p+++++++++++ale al+ + +a+l+ePiqGeaGvv+p gyl lcl|FitnessBrowser__azobra:AZOBR_RS19590 145 RTISIVSFSTDPDARGGFGPFTPGFRTVPFGDAAALEAALTP---NTVAVLLEPIQGEAGVVIPPAGYL 210 ****************************************98...8999******************** PP TIGR01885 210 kkvrelckkynvlliadeiqtGiartGkllaveheevkPdivllGkalsgGvyPvsavladkevmltik 278 ++vr+lc++ nv++i deiqtG++rtGklla ehe+v d+ l+GkalsgG+yPvsavl+++ev+ ++k lcl|FitnessBrowser__azobra:AZOBR_RS19590 211 RRVRDLCTERNVVMILDEIQTGLGRTGKLLAEEHEGVEADVTLIGKALSGGFYPVSAVLSNSEVLGVLK 279 ********************************************************************* PP TIGR01885 279 pgehGstygGnPlasavavaalevlkeeklaeraeklGeelreelkklkkeivkevrGkGllnaivide 347 pg+hGst+gGnPla+ava aa++vl ee ++++a+ G+ + e+l ++++++++e rG+Gl+ a+ +++ lcl|FitnessBrowser__azobra:AZOBR_RS19590 280 PGQHGSTFGGNPLACAVARAAMRVLVEEGMIDNAAAQGAYFLEQLGAIRSNVIREARGRGLMLAVELHP 348 ********************************************************************* PP TIGR01885 348 skangreawdlclklkekGllakptheeiirlaPPlviteeelkeaveiikkv 400 ++ a c l+ +G+lak+th++ ir+aPPlvit+e++++a+e + v lcl|FitnessBrowser__azobra:AZOBR_RS19590 349 EA---GGARRYCEALRARGVLAKDTHDHTIRIAPPLVITREQVDWALEQFDAV 398 99...667789***********************************9988766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (402 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.43 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory