Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate AZOBR_RS05405 AZOBR_RS05405 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >FitnessBrowser__azobra:AZOBR_RS05405 Length = 311 Score = 259 bits (663), Expect = 5e-74 Identities = 138/305 (45%), Positives = 184/305 (60%), Gaps = 4/305 (1%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLE--EHKVEVKDGCIAI 63 LV D+G TNAR L D I ++ D+PSLEA YL H G AI Sbjct: 1 LVADIGATNARFGLIDGTG--IHGSRVLRCADFPSLEAAALAYLGGVAHDARPSRGAFAI 58 Query: 64 ACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAE 123 A P+TGD V MTN W+FS AE++ LG L +INDFTAV++++P L + Q G Sbjct: 59 AGPVTGDAVLMTNRGWSFSTAEVRGKLGLERLAVINDFTAVALSVPRLTAADVRQVGEGA 118 Query: 124 PVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGH 183 PV G+ + V G G+GLGV+ LV + W +L EGGHV AP S+ E+ +L LR H Sbjct: 119 PVPGRVVGVVGPGSGLGVSGLVPGAEGWTALAAEGGHVTMAPVSDRESAVLAQLRKSFEH 178 Query: 184 VSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGR 243 VSAERVLSGPGLVNLY+A+ D++ PE P +++ A A++ C A+ +FC ++G Sbjct: 179 VSAERVLSGPGLVNLYQALCVLDHQEPEPFTPAQVSDAATANTNPHCVEAVEMFCAMLGT 238 Query: 244 FGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDN 303 GNLAL LG GG++IAGGIVP+ F S FR F +KGR ++++ IP Y+I H+ Sbjct: 239 VAGNLALTLGARGGIYIAGGIVPKLGTLFTHSRFRKRFMEKGRMRDFLAPIPTYVITHEL 298 Query: 304 PGLLG 308 P LG Sbjct: 299 PAFLG 303 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 311 Length adjustment: 27 Effective length of query: 294 Effective length of database: 284 Effective search space: 83496 Effective search space used: 83496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS05405 AZOBR_RS05405 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.1993.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-96 308.6 0.0 3.1e-96 308.3 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS05405 AZOBR_RS05405 glucokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS05405 AZOBR_RS05405 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 308.3 0.0 3.1e-96 3.1e-96 1 313 [. 1 303 [. 1 305 [. 0.96 Alignments for each domain: == domain 1 score: 308.3 bits; conditional E-value: 3.1e-96 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiigdf 69 lv+diG tnar++l+ i+ +++++ dfpslea+ yl + + p +g+faia+P++gd lcl|FitnessBrowser__azobra:AZOBR_RS05405 1 LVADIGATNARFGLI--DGTGIHGSRVLRCADFPSLEAAALAYLGGVAHDAR-PSRGAFAIAGPVTGDA 66 89************5..56679999********************9998865.89************** PP TIGR00749 70 vrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtGlG 138 v +tn+ W++s +e++ +l+l++l +indf+ava++++ l d+ q+g ++++ + ++G+G GlG lcl|FitnessBrowser__azobra:AZOBR_RS05405 67 VLMTNRGWSFSTAEVRGKLGLERLAVINDFTAVALSVPRLTAADVRQVGEGAPVPGRVVGVVGPGSGLG 135 ********************************************************************* PP TIGR00749 139 vatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrkge 207 v+ l++ + + + +la+eGghv +aP s+ e +l lrk +++vsaervlsG+Glv++y+al + lcl|FitnessBrowser__azobra:AZOBR_RS05405 136 VSGLVP-GAEGWTALAAEGGHVTMAPVSDRESAVLAQLRKSFEHVSAERVLSGPGLVNLYQALCVLD-- 201 ******.8888****************************************************9988.. PP TIGR00749 208 revsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfiel 276 + e ++ ++s+aa +++++ + +a+e+f+++lG++agnlal+lgarGG+y+aGGivP++ l lcl|FitnessBrowser__azobra:AZOBR_RS05405 202 ----HQEPEPFTPAQVSDAATANTNPHCVEAVEMFCAMLGTVAGNLALTLGARGGIYIAGGIVPKLGTL 266 ....23347899********************************************************* PP TIGR00749 277 lkkssfraafedkGrlkellasiPvqvvlkkkvGllG 313 + +s fr++f +kGr++++la iP +v+ ++ + +lG lcl|FitnessBrowser__azobra:AZOBR_RS05405 267 FTHSRFRKRFMEKGRMRDFLAPIPTYVITHELPAFLG 303 *******************************999888 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (311 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory