Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate AZOBR_RS08115 AZOBR_RS08115 N-formylglutamate amidohydrolase
Query= reanno::acidovorax_3H11:Ac3H11_2548 (270 letters) >FitnessBrowser__azobra:AZOBR_RS08115 Length = 275 Score = 268 bits (685), Expect = 9e-77 Identities = 137/268 (51%), Positives = 173/268 (64%), Gaps = 5/268 (1%) Query: 8 FTFHQGTAPLLVSMPHAGTYVPPVLAARFTDEARQVPDTDWHMERLYAFAKDMGASILVA 67 F F G P+L+S+PH GT VPP +AA TD A +PDTDWH++RLY FA +G L Sbjct: 4 FRFQPGETPVLLSIPHVGTVVPPDIAATMTDSALAMPDTDWHLDRLYHFAPALGIGFLKP 63 Query: 68 THSRYVVDLNRPPDGASLYPG-QSVTGLCPVDTFDDTPIYAQGDVPDDAEVAARRDAVWA 126 SRYV+DLNR PD PG S T LCP+ TFD P+Y G PD EV R A W Sbjct: 64 ILSRYVIDLNRDPDSDLPIPGGASSTELCPLTTFDHQPVYRPGQEPDAVEVRRRIGAYWR 123 Query: 127 PYHAQLRAELSRIRAQHGVAVLWDAHSIRSVLPRFFEGKLPDLNLGTADGASCDPALAQA 186 PYH QL EL ++ + GVAVL+DAHSIRS +PRFF+G++ D +LGTA+G S PAL Sbjct: 124 PYHEQLNGELQALKERFGVAVLFDAHSIRSRVPRFFDGQIQDFSLGTAEGTSASPALVGR 183 Query: 187 LLAIAQSAPGYTGVLNGRFKGGHITRHYGQPAQNIHAVQLEMTQCSYMQEALPFDYLPEV 246 ++ + + ++ V NGRFKGG ITR YG PA NIH++QLE++Q +YM E PF + E Sbjct: 184 VMNVLTATGRFSSVQNGRFKGGFITRRYGNPADNIHSIQLELSQLTYMDEEAPFGFREES 243 Query: 247 AAEVQPHLERLL----EAALAFAAARRK 270 A +V+P LERLL E A AA RR+ Sbjct: 244 ARQVRPTLERLLSLVVEWAWENAAGRRR 271 Lambda K H 0.321 0.135 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 275 Length adjustment: 25 Effective length of query: 245 Effective length of database: 250 Effective search space: 61250 Effective search space used: 61250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate AZOBR_RS08115 AZOBR_RS08115 (N-formylglutamate amidohydrolase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.18171.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-96 308.0 0.0 3.2e-96 307.8 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS08115 AZOBR_RS08115 N-formylglutamate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS08115 AZOBR_RS08115 N-formylglutamate amidohydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 307.8 0.0 3.2e-96 3.2e-96 3 261 .. 4 262 .. 2 264 .. 0.97 Alignments for each domain: == domain 1 score: 307.8 bits; conditional E-value: 3.2e-96 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidv 71 +++q G++P+l+s+Ph Gt +++++++ ++++a+a+ dtdWh+++ly fa lG +++ +sr+vid+ lcl|FitnessBrowser__azobra:AZOBR_RS08115 4 FRFQPGETPVLLSIPHVGTVVPPDIAATMTDSALAMPDTDWHLDRLYHFAPALGIGFLKPILSRYVIDL 72 67999**************************************************************** PP TIGR02017 72 nrdps.gaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhg 139 nrdp+ + ++ g + t+l+P ttfd +p+y+ G++P++ e+++r+ y++Pyh++l+ e++ l++ +g lcl|FitnessBrowser__azobra:AZOBR_RS08115 73 NRDPDsDLPIPGGASSTELCPLTTFDHQPVYRPGQEPDAVEVRRRIGAYWRPYHEQLNGELQALKERFG 141 **98636788889999***************************************************** PP TIGR02017 140 kivlydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrh 208 ++vl+dahsirs++Pr+f+G++ df lGt +g s+ pal +v++v++ + +ssv nGrfkGG+itr lcl|FitnessBrowser__azobra:AZOBR_RS08115 142 VAVLFDAHSIRSRVPRFFDGQIQDFSLGTAEGTSASPALVGRVMNVLTATGRFSSVQNGRFKGGFITRR 210 ************************************************77789**************** PP TIGR02017 209 ygqPqngvhavqlelaqrgyleeetePvaydeakaealravlkellealldfa 261 yg+P++++h++qlel+q +y++ e P+ ++e+ a+++r +l++ll+ ++++a lcl|FitnessBrowser__azobra:AZOBR_RS08115 211 YGNPADNIHSIQLELSQLTYMD-EEAPFGFREESARQVRPTLERLLSLVVEWA 262 **********************.889**************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (275 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.81 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory