Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate AZOBR_RS22360 AZOBR_RS22360 3-hydroxyisobutyrate dehydrogenase
Query= reanno::psRCH2:GFF2390 (296 letters) >FitnessBrowser__azobra:AZOBR_RS22360 Length = 296 Score = 296 bits (757), Expect = 5e-85 Identities = 159/291 (54%), Positives = 193/291 (66%), Gaps = 1/291 (0%) Query: 3 IGFIGLGNMGAPMAHNLLKAGHQLSVFDLNAAAVENLVGAGALPVDSPTAIAQGNAELII 62 I FIGLGNMGAPM NLLKAGH + FDL+ AA AGA P A A G AE+++ Sbjct: 4 IAFIGLGNMGAPMMRNLLKAGHTVLAFDLSEAACTAARDAGATIATGPGAAA-GEAEVVV 62 Query: 63 TMLPAAAHVKGVYLGVNGLIAHSRAGVMLIDCSTIDPHSAREVAKAAAEHGNPMLDAPVS 122 TMLPA HV+ VY +G+IA ++ G + ID ST+D SAR VA AA G+ M+DAPVS Sbjct: 63 TMLPAGKHVREVYTAPDGIIAKAKPGSLFIDSSTVDVDSARFVAAAAEAAGHAMVDAPVS 122 Query: 123 GGTGGAAAGTLTFMVGGSDPDFDHAQPILAAMGKNIVHCGAAGNGQVAKVANNMLLGISM 182 GG GGA A TLTFMVGGSD F A+PIL+AMGK IVH G GNGQ AK+ NNM+LGISM Sbjct: 123 GGVGGAEAATLTFMVGGSDTAFRRAEPILSAMGKAIVHTGGPGNGQAAKICNNMILGISM 182 Query: 183 IGVAEAMALGVALGMDAKTLAGVINTSSGRCWSSDTYNPFPGVLDNVPSSRGYSGGFGSD 242 +GV+EA AL LG+ ++ L V + SSG+CWS +Y P PG + P++R Y GF + Sbjct: 183 LGVSEAFALAEKLGLGSQKLFDVASKSSGQCWSLTSYCPVPGPVPTSPANRDYQPGFAAA 242 Query: 243 LMLKDLGLATEAAKQVRQPVILGALAQQLYQSFSAQGHGGLDFSAIINQYR 293 LMLKDL LA EA + P+ LG A Q+Y F G GG DFS I+N R Sbjct: 243 LMLKDLKLAVEAGQSTGSPLPLGGEAAQMYALFCNAGFGGKDFSGIVNLLR 293 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 296 Length adjustment: 26 Effective length of query: 270 Effective length of database: 270 Effective search space: 72900 Effective search space used: 72900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS22360 AZOBR_RS22360 (3-hydroxyisobutyrate dehydrogenase)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.27851.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-134 433.1 8.6 2.9e-134 432.9 8.6 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS22360 AZOBR_RS22360 3-hydroxyisobutyra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS22360 AZOBR_RS22360 3-hydroxyisobutyrate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 432.9 8.6 2.9e-134 2.9e-134 1 288 [] 6 293 .. 6 293 .. 1.00 Alignments for each domain: == domain 1 score: 432.9 bits; conditional E-value: 2.9e-134 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesv 69 fiGlGnmG+pm +nllkagh+v +fdls +a+ +++aGa++a+ + +a+ ea+vv+tmlPagkhv++v lcl|FitnessBrowser__azobra:AZOBR_RS22360 6 FIGLGNMGAPMMRNLLKAGHTVLAFDLSEAACTAARDAGATIATGPGAAAGEAEVVVTMLPAGKHVREV 74 9******************************************************************** PP TIGR01692 70 yagdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaee 138 y++ +gi+ak+k +sl+idsst+dvdsar va++a+a+G+ ++daPvsGGvgga+a tltfmvGg++ + lcl|FitnessBrowser__azobra:AZOBR_RS22360 75 YTAPDGIIAKAKPGSLFIDSSTVDVDSARFVAAAAEAAGHAMVDAPVSGGVGGAEAATLTFMVGGSDTA 143 ********************************************************************* PP TIGR01692 139 faraepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGr 207 f+raep+l+amgk ivh+G+ G GqaakiCnn++lgism+Gv+ea+al+eklGl ++ l++++skssG+ lcl|FitnessBrowser__azobra:AZOBR_RS22360 144 FRRAEPILSAMGKAIVHTGGPGNGQAAKICNNMILGISMLGVSEAFALAEKLGLGSQKLFDVASKSSGQ 212 ********************************************************************* PP TIGR01692 208 cWsldtynPvPGvveqaPasngykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfaskgag 276 cWsl++y+PvPG+v+++Pa+++y++Gfa+almlkdl+la ea +s++++++lG a ++y+lf+++g+g lcl|FitnessBrowser__azobra:AZOBR_RS22360 213 CWSLTSYCPVPGPVPTSPANRDYQPGFAAALMLKDLKLAVEAGQSTGSPLPLGGEAAQMYALFCNAGFG 281 ********************************************************************* PP TIGR01692 277 kkdfsavikllr 288 +kdfs++++llr lcl|FitnessBrowser__azobra:AZOBR_RS22360 282 GKDFSGIVNLLR 293 **********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (296 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.56 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory