Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate Pf1N1B4_2234 Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)
Query= curated2:Q88AS0 (360 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 Length = 277 Score = 445 bits (1145), Expect = e-130 Identities = 222/277 (80%), Positives = 249/277 (89%) Query: 84 LYSAMLDEQAGVIDDMIVYLTADGYRLVVNAATGAKDLAWMQSQLGDFDVQLLARSEMAM 143 LYSAML+E G++DDMIVY DGYRLVVNA+T +DLAWMQ+ LGDFDV+L RSE+AM Sbjct: 1 LYSAMLNEHGGIVDDMIVYRLEDGYRLVVNASTRNQDLAWMQAHLGDFDVRLNERSELAM 60 Query: 144 LAIQGPQARNRIAQLVSSARAELIRQLKPFEGLDDGDWFIARTGYTGEDGLEIMLPADEA 203 LAIQGP AR++IA+LV+ +R LI+QLK FEG DGDWFIARTGYTGEDGLEI+LPAD+A Sbjct: 61 LAIQGPHARHKIAELVTQSRGTLIQQLKYFEGQTDGDWFIARTGYTGEDGLEIVLPADQA 120 Query: 204 QRFFNELVGAGISPIGLGARDTLRLEAGMNLYGQDIGEHVSPLASNMAWSIAWEPAERDF 263 FFN+LVGAGISPIGLGARDTLR+EAGMNLYGQDI + VSPLASNMAWSIAWEPA R F Sbjct: 121 PGFFNDLVGAGISPIGLGARDTLRVEAGMNLYGQDIHQEVSPLASNMAWSIAWEPATRQF 180 Query: 264 IGRQALESERAEGTAFKLVGLVLEERGVLRAHQVVRVAEIGEGEITSGSFSPTLSKSIAL 323 IGR ALE+E+A+G KLVGLVLEERGVLRAHQVVR+A++GEGEITSGSFSPTLSKSIAL Sbjct: 181 IGRTALEAEQADGVQHKLVGLVLEERGVLRAHQVVRIADVGEGEITSGSFSPTLSKSIAL 240 Query: 324 ARVPMATADRAEVEIRGKWYPVRVVQPAFVRHGKTLI 360 ARVP+ATADRAEVEIRGKWYPVRVV+P FVRHGKTLI Sbjct: 241 ARVPVATADRAEVEIRGKWYPVRVVKPTFVRHGKTLI 277 Lambda K H 0.321 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 277 Length adjustment: 27 Effective length of query: 333 Effective length of database: 250 Effective search space: 83250 Effective search space used: 83250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Pf1N1B4_2234 (Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10))
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.20683.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-89 284.4 0.0 6.6e-89 284.3 0.0 1.0 1 lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 Aminomethyltransferase (glycine Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 284.3 0.0 6.6e-89 6.6e-89 83 361 .. 2 271 .. 1 272 [. 0.93 Alignments for each domain: == domain 1 score: 284.3 bits; conditional E-value: 6.6e-89 TIGR00528 83 ysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllal 146 ys++ln +GG+vDD+ivy+ ++ ++lvvna+t+++Dl+w++ hl ++ + + e+++la+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 2 YSAMLNEHGGIVDDMIVYRLEDG--YRLVVNASTRNQDLAWMQAHLGDFDVRLNERSELAMLAI 63 9*****************99887..*************************99************ PP TIGR00528 147 qGPkaktiledlldkaveg.lkefffvqeaelalkkaliartGytGedGfeiavanekavelwk 209 qGP+a+ + +l+ ++ + ++++ + e++ + +iartGytGedG ei+++ ++a +++ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 64 QGPHARHKIAELVTQSRGTlIQQLKYF-EGQT-DGDWFIARTGYTGEDGLEIVLPADQAPGFFN 125 ******999999999887743444444.4443.4455*************************** PP TIGR00528 210 klveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravlee 273 lv a g+ PiGLgarDtLr+eagm+LyGq++++e++Pl++++ w +++e++ ++fiGr++le lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 126 DLVGA-GISPIGLGARDTLRVEAGMNLYGQDIHQEVSPLASNMAWSIAWEPATRQFIGRTALEA 188 *****.********************************************************** PP TIGR00528 274 qkengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkeleki 337 +++g+++klvGl++ e+g++r + v+ + + +G +tsG++sPtL k+iala+v+ lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 189 EQADGVQHKLVGLVLEERGVLRAHQVVRIA--DVGEGEITSGSFSPTLSKSIALARVP---VAT 247 ************************999995..5599**********************...556 PP TIGR00528 338 Gtklevevrnklvkikvvkklfvr 361 +++eve+r+k ++++vvk+ fvr lcl|FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2234 248 ADRAEVEIRGKWYPVRVVKPTFVR 271 6899******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (277 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.76 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory